KEGG   Ciona intestinalis (sea squirt): 100181959Help
Entry
100181959         CDS       T01056                                 

Definition
carboxypeptidase B-like
Orthology
K01291  
carboxypeptidase B [EC:3.4.17.2]
Organism
cin  Ciona intestinalis (sea squirt)
Brite
Enzymes [BR:cin01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.2  carboxypeptidase B
     100181959
Peptidases [BR:cin01002]
 Metallo Peptidases
  Family M14: carboxypeptidase A family
   100181959
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
7
AA seq 413 aa AA seqDB search
MKFFVGVLFLVQLAVSVRFDGDQVITVVPRTPQHVKLLRDVGRVTEVDFWSPDDASGVLV
GHPVDIRFPGSYAKVAKELLRKAGMSYQIKIENVQELVNKQFDRNGAHTRAGGYDYYVYH
TYDEIQQWISDMATQFPTLARQSLLTTSTEGRAVNMLTLGSSTDKPIFLIDCGVHAREWI
APAFCQFFVHELLTLYETDAQVKTMMDELTWVIVPLLNVDGYEYTWSDDRMWRKTRSNYG
TACSGVDANRNFDINWSGEGASTNPCSNTYCGPSVESEPIVKALSDIIRENTGNIRGYIA
FHSYSQVFVYPYSYAFEDTANADQLYDLSSRASQAIKDTTGMDYTFGPGYDSMYLVSGGS
KDMAYNNQIPLSWTVELRDTGRYGFVLPESQIEGTCQEMYQAMIVIADEAMKG
NT seq 1242 nt NT seq  +upstreamnt  +downstreamnt
atgaagttttttgttggagttttgttcctcgtgcagctcgctgtttctgtgaggtttgat
ggagaccaggtgattacagttgttccacgaacaccacaacacgtcaaattgctacgagac
gtgggaagagttacagaggtcgatttttggagtccagatgatgcatctggtgttcttgtt
ggacatccagtcgacattcgatttccaggatcttatgctaaggtggccaaagagcttctc
cgaaaagccggcatgagttaccagatcaagatcgagaacgtacaagaactcgtcaacaag
cagtttgatagaaatggggctcacacacgagctggaggttacgactactatgtttaccac
acttatgatgagattcagcagtggatttcagacatggcaacccagtttccaaccctggcc
cgacaaagcttattgaccacttctacggaaggccgtgcagtaaacatgctcacacttggt
tcttctaccgataaaccgatctttcttattgattgtggagttcatgctcgtgaatggatt
gcaccagcattctgccaattctttgtgcatgagttacttactttatatgagacggatgcg
caagttaagacgatgatggacgaactgacgtgggtgattgttcctcttttgaacgttgat
ggttacgaatacacctggtctgacgaccgaatgtggcgaaagacaagatccaactacggc
accgcttgctctggtgttgatgcgaacaggaatttcgatattaactggtcgggagagggc
gcctcgaccaacccatgcagcaacacatattgtgggccatctgttgaatcggaacctatt
gttaaagctctctcagacattattcgggaaaatactggaaacataagaggttacatcgca
ttccacagctacagccaggtgttcgtgtacccttactcatacgcattcgaggatactgcc
aacgcggatcagttgtatgacttgtcctctcgggcttcccaggcgatcaaagacactact
ggaatggattataccttcggacctggctatgattctatgtaccttgtttctggtggttca
aaagatatggcttacaacaatcagatcccattatcgtggacggtcgaattgagagatact
ggtagatacggctttgttctgccagagtcgcagatcgaaggaacttgtcaagaaatgtat
caagccatgatcgtgatcgctgacgaggcaatgaaaggttga

DBGET integrated database retrieval system