KEGG   Ciona intestinalis (sea squirt): 100181980Help
Entry
100181980         CDS       T01056                                 

Definition
trifunctional enzyme subunit alpha, mitochondrial-like
Orthology
K07515  
enoyl-CoA hydratase / long-chain 3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.211]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:cin00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100181980
   01212 Fatty acid metabolism
    100181980
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100181980
   00650 Butanoate metabolism
    100181980
  Lipid metabolism
   00062 Fatty acid elongation
    100181980
   00071 Fatty acid degradation
    100181980
   01040 Biosynthesis of unsaturated fatty acids
    100181980
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100181980
   00310 Lysine degradation
    100181980
   00380 Tryptophan metabolism
    100181980
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100181980
Enzymes [BR:cin01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     100181980
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     100181980
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 765 aa AA seqDB search
MSSLIRTLRHPCLKRHLFLKRHSGERHLSISSLLNGKHMNIDYQDDVAVVRLDKADAKMN
TLSTEVMTEFQDIFNEIQRNKSVKAAVLISAKPGNFVAGADIDMLKNAGSAEETTALAKN
GQRLFHELENSKKPFVAAINGVALGGGLELTLACQYRIATTDKSTNLGVPEVMLGLLPGA
GGTQRLPQLVGVASALDMALTGKNIKAKKAKRMGLVHQLVEPLGPGLVDAQTGTMQYLER
IAVDTARGLANGSVKIPPIKHSQQDRIIAYLLKFGFFENYFFNKMIKGKVMKQTKGLFPA
PLLIADVIREGVINGHDKGYEAEAAGFGKLSQTNESKALIGLYDGQTHCKKNRFGKPAKP
AQNIAVLGAGLMGAGIAQVSMDKGYNVTLKDSFSSGLAKGQEQIYKGYNLSAKKKKITTF
ERDQIVAKLDATLSYDSLKTSDMVIEAVFEDINIKHKVIKETEAVIPEHCIFASNTSALP
ISDIAKASKRPEKVIGMHYFSPVDKMQLLEIITTDTTSKDTVASAVQVGLKQGKLVIVVK
DGPGFYTTRLLAPTLSEVIRMLQEGVGPQKIDKLATSFGFPVGIATLLDEVGIDVAVHVS
EYLGGVFGDRFAGGNVQVLKNLVDSGCAGRKTGKGVYVYSDAKAKTRPVNDTATKILKEF
AMEPVDAVSSDSDIQLRLISRFVNEAVMCLQEGILDNPLEGDIGAVFGLGFPPHLGGPFR
YVDLHGAAPLVEHMRRFEAAYGPAFTPCSLLLEHAKDSSKKFHLS
NT seq 2298 nt NT seq  +upstreamnt  +downstreamnt
atgtcttcacttattcgaacactgagacacccatgtttgaaacgtcatttatttttaaaa
agacattctggtgaacgacatttatcaatttcatctttgttgaatggcaaacacatgaac
attgactatcaagatgatgtagctgttgtaagattggacaaagcagatgcaaaaatgaac
acactaagcactgaagtaatgactgagtttcaagatattttcaatgaaattcaaagaaac
aaatctgtgaaagcagccgtgctaatatctgccaagcctggaaactttgtagctggtgct
gatatagatatgcttaaaaatgctggaagcgctgaagagacgacagctcttgcaaagaac
ggacaacgacttttccatgaacttgaaaacagcaagaaaccatttgttgctgcaatcaat
ggtgtagcattgggaggaggacttgagctaacactggcttgccaatatagaatcgcaact
actgacaaatccaccaaccttggagtgcctgaagttatgcttgggttgttaccaggtgct
ggaggaacacagagacttccacagttagtaggagttgcatcagcattagatatggcactt
acagggaagaacattaaagctaagaaagcaaaaaggatgggcctcgttcatcaacttgta
gaaccgctgggtcctggattggttgatgcacaaacagggaccatgcaatacctggagagg
attgctgttgatacagcacgtggcctcgctaatggaagtgtgaaaataccaccaatcaaa
cattctcaacaagacagaataattgcttaccttctaaagttcggattcttcgaaaattat
ttcttcaataaaatgatcaaaggaaaagtaatgaaacaaaccaaaggtttattccctgca
cctctgcttattgctgatgttataagggaaggggtaataaacggacatgacaaaggatat
gaagcagaagctgccggatttggaaagttgtcgcaaacaaatgaatctaaagcccttatt
gggttgtatgatggacagactcactgtaagaagaatcgatttgggaagccagctaaacct
gctcagaacatagcagtacttggtgctggcttaatgggtgcaggcatagcacaagtaagc
atggataaaggttacaatgttacgctgaaagattccttcagttctgggttggctaagggt
caggaacaaatctataaaggttataatttgtctgcgaagaagaagaaaataacaactttc
gaacgtgaccaaattgttgcgaaacttgacgcaactctttcttatgattcactcaagaca
tcagacatggtgatcgaggccgtgttcgaagatatcaacattaaacataaagttatcaaa
gaaactgaagctgtgatacccgaacattgtatatttgcatcaaacacttcagctctccca
atatcggatattgccaaggcaagcaagaggccagaaaaggtaataggaatgcattacttt
tcaccagtggataaaatgcagctgttagaaatcattacaacggacacaacatctaaagat
acggtcgcttctgctgtacaagttggtttaaagcaagggaaacttgtcatagttgttaag
gatggtcccgggttctacacgactcgtctcctcgctcccactctctccgaagtaatccgg
atgttgcaggaaggtgttggtcctcagaagattgataaactcgcaacatcattcggattt
cctgtcggaatcgcgactctgcttgatgaggttggtatagacgttgctgtccacgtgtct
gaatacctggggggtgtgtttggtgatcggtttgcagggggtaatgtacaagtgctcaag
aaccttgttgacagtggttgtgcaggtcgcaagacaggaaaaggcgtttatgtttattct
gatgcgaaagcaaagacgcgaccagttaacgacacggctaccaagatattgaaggaattt
gccatggaaccagttgatgcagtttcaagcgacagcgatatccaactccgattaatatcg
cggtttgtaaacgaggcagtgatgtgcttgcaggaaggtatcttggataaccctcttgaa
ggagacataggagcagtgtttggccttggattcccaccacacttaggaggtcccttccgc
tacgttgacctgcatggtgctgcgccactagttgaacatatgcgtcgattcgaggctgca
tacggaccagcattcaccccatgctcactgctgctagaacatgcaaaagattccagcaag
aaattccacttgtcctag

DBGET integrated database retrieval system