KEGG   Ciona intestinalis (sea squirt): 100182086Help
Entry
100182086         CDS       T01056                                 

Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-1
  KO
K05858  
phosphatidylinositol phospholipase C, beta [EC:3.1.4.11]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Wnt signaling pathway
AGE-RAGE signaling pathway in diabetic complications
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:cin00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100182086
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    100182086
   04070 Phosphatidylinositol signaling system
    100182086
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    100182086
Enzymes [BR:cin01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     100182086
Membrane trafficking [BR:cin04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    100182086
 Endocytosis
  Macropinocytosis
   Phospholipase C
    100182086
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
4
AA seq 1343 aa AA seqDB search
MAGAESAVHRVIVEKPSIPERLINGSKFIKWPKSDNDDSIIAVQVTLKIDPKGHIIYWQE
PGRDTECLEISSIRDTRVGKYAKEPKQEKLERSAQNSGDPQLIKMVCNSSVPVVEKCLTI
VYGVKLVELSFLNFICVELDPQQCVKEWADFLLELAYHPCTRHISVQTSIEKAYTRLKLE
TNQFGEIPVKKLIKVLGGKIKRVNHALASVGLVPGRTDVSIKPDDFHLSGFKKLLQLCCL
RPELDSVFSKLGTGARRMYVSHQKFKDFINNEQRDPKLNDLLYPFHTDDQAQDAITNFEP
NEMFATKGQLTLEGLDAYLQSDDNLIVGLDKFAEHQAMNAPLSHYFINSSHNTYLTGTQL
RSKSSAEIYRQVLLTGCRCVELDCWEGDEEPVINHGFTLCTHVLFREVIEAINESAFKTS
PYPVVLSFENHVDNPQQQAKMAQYCRDIFGDKLLIDPLSKYPIVADSSLPPPCDLKYKII
VKNKKQRPAAETNPKSPNEDSIKDKKRPSIVSESPQSPGAEFSKASRRSLHNRESSSSSL
STEKSSRPSSRTESANRKQTVASRVSATVDEVAETEEEEEKVNGSEVIQGEDTKKSSSSS
IGSTDASQEKSDSNENSDKTNSGGEESKSSENSVEQENSEENGEDGEKTEKTSNAKETKD
EDEDSEDEGSITTLDYEENAKECGTAMKESKAYEAMSSLVNYVQPVRFKSFELSERRKRC
YEISSFTESAALRLLTFYPMEFVRYNRRQMSRIYPKGARVDSSNYMPQIFWNAGCQFVAL
NFQILDLAMQLNMGLFEFNGSSGYILKPLPMRNKDKTFDPFSKNLDGVVATSLKIQIISG
QFLSSSKVSTYVEVDMYGLPADTIRKRLKTKVVESNSLNPCYNSEVFTFNKIVLPCIAIL
RIAVMETNGSMLGQRFLPVDALKPGYRYITLRNEGNQPLTMPSLFVHLEVADFVPEVHLK
FMEALANPIPFMKEKDREEQEMKNRQKALQLLLEEDEKEKVEDKPLDSDNESEKPKPASD
KKEKKPTVETTTKDGDSIPLPKPVKASKSKQEKNEVLLEVFEPQNLNDLRLNEGYLKIIK
ESEKGINKLKKKHKKTFSKCHGQLFPARSPSLLNLFFTRRRLSAADVTIDVNPAMPDEIK
KKEMFKLLEEQFDAEKTYQIEQTDNFVRKLESFVRDHQKVEMERLTKTSAKEQAALQRQK
DAEKEQNIRAIPVNLGKDEIERKKREINSSHIEECVRIRGSLLLKQEEREKEVLCQQEEI
LASVEDERKKMLEKIEQDYQESMRNVEGVYEIRKLELNQKNGAVSAYNDTADALQNRTEL
LTVPPVFDPSRRASGGQLLITGV
NT seq 4032 nt NT seq  +upstreamnt  +downstreamnt
atggctggagctgaatctgctgtacacagagttattgtcgaaaagccaagtattccagaa
agattaatcaatggaagcaaatttattaaatggcccaagtcagacaatgatgattccatc
attgctgtgcaggttacgttaaaaattgatccgaaaggtcacatcatatactggcaagaa
cctggaagggataccgaatgtttagaaatttcaagcataagggatactagggttgggaag
tatgcaaaggaaccaaagcaagaaaagcttgaaagatcggctcaaaatagtggggatcca
caactcattaagatggtatgcaactcatcagttccggtggttgagaaatgtctcacgatc
gtgtacggtgtcaagctggttgagctttcctttctaaacttcatctgtgttgaactagat
ccccaacaatgtgtcaaggaatgggccgattttcttttggagcttgcttatcatccatgt
acacgacatatatcagtgcaaacatctatagagaaagcgtacacccggttaaaactagaa
acaaatcagtttggggaaattcctgtgaaaaaattgataaaagtactaggtggtaaaata
aagagagtgaaccatgcattggcatcagtgggacttgtacctggcaggactgatgtttca
attaaaccagacgactttcatttatctggatttaaaaagttgctccagttatgttgtctt
cgaccagagttggactcggtgttttcaaaattaggtacaggtgcaagaagaatgtatgta
tcgcaccaaaagtttaaggacttcattaacaatgaacagagggatccaaaattaaatgat
ttgctttacccgtttcatacggatgaccaagcacaggatgcaatcactaactttgaacca
aatgaaatgtttgctaccaaaggtcagttaacattggaaggtctggacgcttatcttcaa
tccgatgacaaccttattgttggtttggataaatttgctgaacatcaagcaatgaatgca
cctctgtctcattacttcatcaattcttcacataatacatatctaaccggtactcaatta
agaagcaaatcatcagccgaaatatatcggcaagttttgctcactggatgtcgctgtgtg
gagttggattgttgggagggggacgaggagcccgtgatcaaccatggatttactctttgt
actcacgtcctcttccgtgaagtaattgaagcaatcaatgaaagtgcgttcaaaacttca
ccttaccctgtggttctatcatttgagaatcatgttgacaatccacaacagcaagcaaag
atggcacaatattgtcgcgatatatttggggataaattactgattgacccgcttagcaag
tatcctattgttgcagactcaagtctacctccaccttgtgacctaaaatacaaaattatc
gtgaaaaacaagaaacaacgtccggctgctgaaaccaatccaaaatcaccaaatgaggac
agcattaaagataaaaaacgaccgtcaattgtttccgaatctccacaatctcctggggct
gagttctccaaagcatctcgtcgtagtttacacaacagagaaagctcttcaagctccctg
agtacagagaagtcctcacgaccgagttcacgaacagaatcagcgaatcggaaacaaaca
gttgcatcccgtgtgtccgcaactgtggatgaggtggcggagactgaagaagaagaagag
aaggttaatggatcagaagtcatccagggagaggacacaaaaaagtcctcttcatcttca
attggttcaactgatgcttcacaagaaaaatccgacagcaatgaaaattctgataaaacg
aactcaggtggcgaagaatcaaaaagcagcgaaaattctgttgagcaagaaaacagtgaa
gaaaatggagaggatggtgaaaagactgagaaaactagcaacgctaaggaaactaaagat
gaagacgaggacagtgaggatgaaggcagcatcacgacacttgattatgaggagaatgct
aaggagtgcggaactgcaatgaaagaatcaaaagcttacgaagctatgtcatcgttagtc
aactatgttcaacctgttaggttcaaatcatttgaattatctgaacgaagaaagcgatgt
tatgaaatttcttcattcactgagtctgctgctctgcgtcttcttaccttctacccgatg
gaatttgtgcgttacaatcgtcggcagatgagcaggatctaccccaagggagctcgtgta
gattcatcaaactatatgccacagatattctggaacgctggttgtcagtttgtggcactt
aacttccaaattttggatcttgccatgcaactaaacatgggcttatttgagtttaatggt
tcatctggttatattcttaaacctctccccatgagaaataaagacaaaacttttgacccg
ttttccaagaacttggatggtgttgtagctacaagtctaaaaattcaaattatatctggt
cagtttctttcctcttcaaaagtaagcacctacgtagaagtggacatgtatggcttacct
gccgatacaataagaaaacgattaaagacaaaagttgtcgaaagcaactccctcaaccca
tgttacaatagtgaggtgtttacattcaacaagatcgtgcttccatgtattgctatacta
cgcatagcagtaatggaaactaatggaagtatgttgggtcaacgattcctgcctgttgat
gcacttaaacctggttacagatacatcacacttcgtaatgagggcaaccaaccactaacc
atgccatctttattcgttcatcttgaagttgctgactttgtccctgaagtgcatttaaaa
tttatggaagcactcgcaaacccgatcccatttatgaaagagaaagatagagaggaacaa
gagatgaagaatcggcagaaagctctccaacttctcttggaggaggatgagaaagagaaa
gttgaagacaaacctttagattccgataatgagagtgaaaaacccaaaccagcttcagat
aaaaaagagaaaaaaccaacagtagaaacaactactaaggatggagattcgattccttta
cctaaaccagtaaaggcaagcaagtcaaaacaggagaagaatgaagttttattggaagta
tttgagccacaaaacttgaatgacttgcgtctgaatgaaggttacttgaaaatcatcaaa
gaaagtgagaagggaataaataagttgaaaaagaaacataaaaagacattttcaaaatgt
cacggccagctctttccagcacgaagcccatctttactcaacttattctttacaagaaga
cgactatctgctgcagatgttacaattgacgtcaaccctgcaatgcccgatgaaataaaa
aagaaagaaatgtttaagttacttgaagaacaatttgatgcagaaaaaacctaccagatt
gaacaaacagataattttgttagaaaattggaaagttttgttcgtgaccaccagaaagta
gagatggaaagattaactaaaacatctgcaaaagagcaagcagctcttcaaaggcagaaa
gatgcggagaaagagcaaaacatccgagccatccctgtcaaccttggtaaagatgaaatt
gagaggaagaagagagagatcaactctagtcatatcgaggagtgtgtccgcatccgtgga
tcattgttattaaaacaagaagaacgtgaaaaggaggttctttgtcaacaagaagaaatc
ttagccagtgttgaagatgaaagaaaaaagatgctggagaaaattgagcaggattaccag
gagagcatgagaaatgttgagggggtttacgaaatccgcaaattggagctcaaccagaag
aatggtgcagtgagcgcctacaatgatacggcagacgccctccaaaacaggacagagctg
cttaccgttcccccagtattcgatccaagtagacgggcgtctggtggtcaacttctcatt
actggtgtttaa

DBGET integrated database retrieval system