KEGG   Ciona intestinalis (sea squirt): 100182089Help
Entry
100182089         CDS       T01056                                 

Definition
ubiquitin carboxyl-terminal hydrolase 48-like
Orthology
K11858  
ubiquitin carboxyl-terminal hydrolase 48 [EC:3.1.2.15]
Organism
cin  Ciona intestinalis (sea squirt)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 1077 aa AA seqDB search
MGRKSANKSNEPLVWQWVDDADPSKIGDKEVRTAYRLNLPKCTSCRKNCQAKPTCLFGLG
EAQWLSSPSHLEWENIEQKLEKQIEAEKRKEGELVGLKNLGATCYVNTYLQLWYHNVSFR
NALYNLEYKDEDLALQQTLCGQLQLIFGLLESSISKSVDPSHFIKCLGLATDLQQDAQEF
SKLFLSLLENTPSLSQVIKEQFCGQYTYVTVCKSCQSVTERPSNFYELDLNVQGHKDLKS
CILEFLREEKLVGENQYYCTKCQSKQDALRKIALKKLPETLNLQLLRFVYDRSSQRRQKI
VTSLTFPDHLDLSSMVDKNVTTLSQSDTQYKLTAVLIHRGLSASSGHFVAHILEPESGNW
YKFNDEVVAKMKSGKKLDLDSYKGEDTVCTELLQEPAPKKMKLLKGNHSSKDVYMLVYTK
VSDKNLAMVPVPATVQQLVDEHNAVKATRLKGIRKEAEEKQLKDVELRKHMIRFIHLLHS
EENFGHRLLPTKVLKQFMNSAKSDAVFKPEVNYLCQHGNLKVDKAVTLKYIPKSAADIIQ
STYPLFKPIPDSMLCHACVKNHCLLIQAKKRLKKDNLFVSESLKTLQNGSTEMDTDLFYV
GKQSLKRWRSLAMQEVLKKYASTSNNNIMADSTDSKSNATGNNESSDESDETFNSDLLCN
HNHLTIEKSAFQLVPHYLWEILHHYFPDCVEFKYASADPCTTCQSDVLFHEKELTTRKEI
AAIQKANLHQLFLNKNRPSLAFLYDVEFSKQQANQTEFFIVPSQFVDHWKDFVRHPDKNE
PVVSVINKNFLCPHNMLLYDPALNLKSTESTVSNCEQQCEVLWCSEWRYIKENFSVDHEI
QISKTFPSECFVVLQNMDHTNLNGNASTNGTEIVDLTGSDQSPSVIIKSDAENQSAKTNV
ENKCNIPKPVARLVYSPGLCATCMKGLEQKRFEEMCKYDDGEIYVLKSTQPSQEFCSLST
KNIETLPKETRRGKRVRRCVRGEKKLSNLSSNLTLKELKIRIMNQFSIPPFDQNLWLNGR
KLTHDDWTLESLKIIPGCTLNLVEDIPAPDSALIVYESVKTTEPETGFQGTGLLGYH
NT seq 3234 nt NT seq  +upstreamnt  +downstreamnt
atgggaaggaagagtgcaaacaaatccaatgagcctcttgtatggcagtgggtggatgat
gctgatccttcaaaaattggtgacaaggaagtaagaacggcttacaggctcaatctacca
aaatgcacatcatgtagaaaaaactgccaggccaaacctacttgtctgtttggattgggg
gaagctcaatggctgagctctccttctcaccttgagtgggaaaacatagaacagaaattg
gagaaacagattgaagcagaaaaaaggaaagaaggggagctggttggtctaaaaaatctg
ggagctacttgttatgttaatacctatctgcagttgtggtatcataatgtctcatttcgg
aatgctctttataacttggaatacaaagatgaggaccttgctctgcagcaaacattgtgt
ggccaattacagcttatattcggtttattagaaagcagcatttcaaaatccgtagacccg
tctcattttattaagtgtcttggtttggccactgatttgcaacaggacgcacaggagttt
tcaaaattgttccttagtttactggaaaacacaccttccctgtctcaagtcattaaggag
cagttttgtgggcagtacacatatgttactgtttgtaagtcctgtcagtctgttactgaa
cgaccgtctaatttttatgaacttgatttgaacgttcagggacacaaggatttgaaaagt
tgtattttggagtttctgcgtgaggagaaactagtgggtgagaatcagtactactgcact
aaatgtcaaagcaaacaagatgctttgaggaaaatcgcattaaaaaagctacctgaaact
ttaaatctgcagttgttgcgttttgtgtatgataggtcgagccaaaggcgtcagaaaatt
gtgacaagtttaacatttcctgatcatctggatttgtcatccatggttgataagaatgta
acaacgctatctcagagtgatacacagtacaagttgactgctgttcttatacatcgaggc
ttgagtgcatcttcaggtcacttcgtagctcatattttggaacctgaaagtgggaactgg
tacaagttcaatgatgaggtcgtagccaaaatgaaaagtgggaaaaagcttgacttagac
agttacaaaggagaggatactgtttgtacagaactactgcaagaacctgctccgaaaaag
atgaaattattaaaaggaaatcattcttcaaaagatgtctacatgttggtttataccaag
gtgtctgacaaaaacctggcaatggttccagttcctgctacagttcagcagcttgtggat
gagcacaatgcagtgaaagcaactcgtttaaaaggaattcgtaaggaagccgaagaaaaa
caactgaaggatgtagaactaagaaagcatatgattcgttttattcatcttttacattcg
gaagaaaactttggacaccgtttgttgccgacaaaagtcctgaaacagtttatgaattcg
gccaagtcggatgctgtttttaaaccagaggtgaattacttatgtcaacatggaaatctt
aaagtggacaaagctgtaacgctcaagtacataccaaaaagtgctgcagatatcattcaa
agcacttacccattattcaagcctatacccgattcaatgctttgtcatgcttgtgttaaa
aaccactgtttgctcatacaggcaaagaaaaggctaaaaaaagacaatttgtttgtttcc
gaatcacttaaaacgttacagaatggaagtacagaaatggatacagatttgttttatgtg
ggcaaacagtctctcaaaaggtggcgctctttagcaatgcaggaggttctaaaaaaatat
gcttcaacctcaaataataatatcatggcagactcaactgacagtaaaagcaatgcaact
ggaaacaatgagagctcagatgaatctgatgagacctttaactctgacctgttatgcaat
cataatcatttaaccattgaaaagtctgcatttcaacttgtgcctcattacctttgggaa
atactacatcattacttccctgattgtgttgagttcaagtatgcaagtgcagatccctgt
accacttgtcaatcagatgtcttatttcatgaaaaggaattaaccacacggaaagaaatt
gcagcgattcagaaagccaatctacatcaattatttttaaacaaaaaccgtccatcactt
gcgtttttatacgatgttgagttttcaaagcagcaggcaaatcaaacagagttctttatt
gttccttctcagtttgtggatcattggaaggattttgttcgccatcctgataagaatgag
cctgttgtttcagttattaataaaaatttcctctgtccacataacatgcttctttatgat
ccagcattgaatcttaaatctacagaaagcactgtgagtaactgtgaacaacagtgcgag
gtgctatggtgttcagaatggcgatacatcaaggaaaattttagtgttgatcatgagata
caaatcagcaaaactttcccatcggagtgttttgtggtacttcaaaacatggatcatacc
aatttaaatggaaatgcttcaacaaatggaactgaaattgttgacttaactggcagtgat
cagtccccttcggttattattaaatcagatgcagaaaatcaatctgcaaaaacaaatgtt
gaaaataaatgcaatataccaaaaccagtagcgcgattggtatattcaccagggctgtgt
gcaacctgcatgaaagggttggaacaaaaaagatttgaagaaatgtgcaagtatgacgat
ggtgagatctatgtattaaaatctactcaaccctcccaagaattttgcagtttatcaacg
aaaaacattgaaactttgcccaaggaaacaaggcgtggaaaaagggttcgaagatgcgta
cgaggggaaaaaaaattaagtaacctgtcctccaatctaactttaaaagaactgaaaatt
cgaataatgaatcaattctcaattcctccatttgaccagaacctttggctcaatggtcgg
aaattaactcacgatgactggactttggaaagtctaaagattataccaggttgtactttg
aaccttgtggaggacatacccgcaccagacagtgcactgattgtttatgaatcagttaaa
acaacagaacctgaaactggctttcaaggcactggactacttggttatcactag

DBGET integrated database retrieval system