KEGG   Ciona intestinalis (sea squirt): 100182144Help
Entry
100182144         CDS       T01056                                 

Definition
elongator complex protein 3-like
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
cin  Ciona intestinalis (sea squirt)
Brite
Enzymes [BR:cin01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100182144
Transfer RNA biogenesis [BR:cin03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    100182144
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
8
AA seq 548 aa AA seqDB search
MGKATEPTASQAELLAISTAEIVRVLIDAHDSGQDINLNKLKGRISSKHGLKSQPRLTDI
IAAVPHQYKKSLLPKLRAKPVRTASGIAIVAVMCKPHRCPHINMTGNICVYCPGGPDSDF
EYSTQSYTGYEPTSMRAIRARYDPFLQTRHRVEQLKQLGHSVDKVEFIVMGGTFMSLPDT
YKDYFIRNLHDALSGHRSNNVEEAVKYSERSRTKCIGITIETRPDYCLKKHQSEMLTYGC
TRLEIGVQSVYEDVARDTNRGHTVRAVSESFQIAKDCGFKVVTHMMPNLPNVRLERDIEQ
FVEFFENPAFRPDGLKIYPTLVIRGTGLYELWKTGRYQSYPPSTLIDLVAKILALVPPWT
RIYRVQRDIPMPLVSSGVEHGNLRELALARMKDLGTTCRDVRTREAGIQQIHHKVKPYEV
ELIRRDYTANGGWETFLSYEDPEQDILVGLLRLRKCSQEAFRPELKGKGASLVRELHVYG
SVVPVSSRDPAKFQHQGFGTLLMEEAERIALEEHGSSKLVVISGVGTRNYYRKLGYELDG
PYMSKNLI
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgggaaaggcaacggagccaacagcttcccaagctgaactgcttgcaatttctactgct
gaaattgtgcgtgttttaattgatgcccatgactcggggcaagacattaatttaaacaaa
ctgaaaggaagaatttcatcgaaacatggcttgaaatctcaaccaagacttacagacatt
atagcggctgttccacaccagtataagaagtcacttctacccaaactgagggcaaaacct
gtcagaactgccagtgggatagcaattgtggctgttatgtgcaaacctcatagatgccca
catataaacatgaccggtaacatttgtgtgtattgtccaggaggtccagactctgacttt
gagtattcaacacagtcttacacaggatatgaacccacttctatgagagcaatacgtgcc
cgttatgacccatttttacaaaccaggcacagagttgagcaactgaaacagcttgggcat
tcagtggataaagtcgagtttatagtcatggggggaactttcatgtcattacctgataca
tataaagactactttataaggaatctgcacgatgccctctcaggccacaggagtaataat
gtagaggaagctgttaaatacagcgagagaagccgcacaaaatgcattggtataaccatc
gaaacaaggccagattactgcctcaaaaaacaccaaagtgaaatgttaacatacgggtgt
acgagacttgaaattggtgttcaaagtgtgtacgaggatgtagcacgtgacactaacaga
ggacacacagttcgtgctgtatcagagtcatttcaaattgcgaaagattgtggtttcaaa
gttgtcacccacatgatgccaaacctgcctaatgttcgcttagaaagagacattgaacaa
tttgttgagtttttcgaaaacccagcctttcgacctgatggtcttaaaatatatccaacg
ttagtaattcgtggaacaggtttgtatgagttgtggaaaactggtcgataccagagttat
ccgccttctacattgattgatttggttgctaagattcttgctcttgttcccccatggaca
agaatttacagagtacaaagagatatcccaatgccactggtatcatctggagtagaacat
ggtaacttaagggaattggctcttgcaagaatgaaagatctcggcaccacatgcagggat
gttcgtactagagaggccgggatacaacaaatacatcataaagtgaaaccatacgaagtt
gaactgataagaagggactacacagcaaatggtggctgggaaacatttctttcatatgaa
gacccagagcaagatattttagtcgggcttttgagactcagaaaatgttcacaagaagct
tttcggcctgaattgaaaggcaagggtgcgtccttggtacgcgaactgcatgtttatggt
agtgtggttcctgtgagttctagggatcctgctaagtttcaacatcaagggtttgggact
ttgctgatggaggaagcagagcgtatcgctcttgaggaacatggatcgtctaaacttgtc
gttatctcaggagtgggcacgaggaactattacaggaaacttggttatgagttggatggt
ccatacatgtcaaagaacttgatataa

DBGET integrated database retrieval system