KEGG   Ciona intestinalis (sea squirt): 100182197Help
Entry
100182197         CDS       T01056                                 

Gene name
gpx_b
Definition
glutathione peroxidase_like protein b
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:cin00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    100182197 (gpx_b)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100182197 (gpx_b)
Enzymes [BR:cin01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     100182197 (gpx_b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 208 aa AA seqDB search
MRSAVLLWLGVAGVVHSMVPCYNSTNYSVYSNQVFNLHKQNVNLSRFHNEVTLLINVATY
UGLTVAQYTGLNALLTHFNGRNFSVLAFPCDQFHLEEPGEDSEILNGLMYVRPGNGYVPH
PKLNIFGKIKVNGRHEHTIYKNVKASCPPTTLNLGSTRNMYWNPVKSTDITWNFNKFLLD
KNGVPRYRISSDASPTSLIPYITTMLSE
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgcggtctgctgtgttactgtggttaggtgtggctggtgtggtacactctatggttcca
tgctataactccacaaattactccgtgtattcgaaccaagtgtttaacctccataaacaa
aacgtgaatctgtcaaggtttcataatgaagtcacattactgatcaacgtggcgacttac
tgagggttaactgtcgcccaatatactgggcttaacgcacttttaacgcacttcaacggt
agaaactttagtgtcctcgcttttccatgcgaccagttccacctcgaggaaccgggtgaa
gacagtgaaatcttaaatggtttgatgtacgtgagacctggtaacgggtatgtacctcac
cccaagctcaatatatttggtaaaataaaagtgaacgggaggcacgagcacacgatttac
aagaatgtaaaggcttcttgtcccccaaccactttaaacctgggctctacgcgtaacatg
tattggaacccggttaaatcaaccgacataacttggaattttaataaatttcttcttgac
aagaatggagtgccaaggtatcgtatcagtagtgatgcctcacctacgtcacttatccct
tacatcactacaatgctatccgagtaa

DBGET integrated database retrieval system