KEGG   Ciona intestinalis (sea squirt): 100182315Help
Entry
100182315         CDS       T01056                                 

Definition
protein disulfide-isomerase 2-like
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:cin00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100182315
Enzymes [BR:cin01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100182315
Exosome [BR:cin04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   100182315
  Exosomal proteins of colorectal cancer cells
   100182315
  Exosomal proteins of bladder cancer cells
   100182315
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 568 aa AA seqDB search
MNNLLKLLFVSFVFGLVSSEVPDATPEVKEENGVLILTNDNFDSVVTETKHVLVEFYAPW
CGHCKALAPEYAKAAAQLKEEGSEVKLGMVDATVETELGTKFKVQGYPTLKFFKNGSPLE
YGGGRQAADIVSWLKKKTGPPTVPLENAEAVANFKKDNEVVVIGYFPDSESDGHLSFKKV
ADEIDDVMFGSIHTAEAAAESDIAENTVTVFKQFDEGRADYDGAVTDGDLLNKFVKENQL
RLVTEFTSESAPKIFGGDIQIHNLLFIPKLSQESQDHLTAFTEAAKQFKGKVLFIYIDTD
SEENKRVMEFFGLTDADIPDYRIIKMSENMAKFKPDTKELTTEAIAAFTNKVVTGEVQRH
LMSAEIPDDWDKNPVTVLVGKNFEQVAYDKKKKVFVEFYAPWCGHCKSLAPTWDKLGEKY
SDNADVVIAKMDSTANELSQFEISGFPTLKFFPEVAEGEEQKVLDYDGDRTVEAMAAFID
SNGEKGNVATKPLPPKETEPPADFNPNQIKDDMHKELEDVVPKGDPKEMLEKQAEKEKQE
KQKTAEPKEGEKRVPQPEPKKGKEKKEL
NT seq 1707 nt NT seq  +upstreamnt  +downstreamnt
atgaataatttgttaaagttgttgttcgtttctttcgtttttggtcttgtttcttcagaa
gtaccagatgcgacaccagaagtaaaagaagaaaacggtgttttaattttgaccaacgat
aacttcgactccgttgtcacagaaaccaaacatgtccttgttgaattctatgctccatgg
tgtggccactgcaaagcacttgcccccgagtatgctaaagcagcagcccagttgaaagaa
gagggatctgaagttaaacttggcatggttgatgccacagtagaaactgagctaggaaca
aaattcaaggttcagggttaccctacccttaaattcttcaaaaacggctcaccgctggaa
tatggaggtggaagacaagcagcagatatcgtaagttggttgaaaaagaagactggacca
ccaaccgtaccccttgaaaatgctgaagccgttgctaactttaagaaagataatgaagtt
gttgttattggatatttcccagatagtgaaagtgatggacacctgagcttcaagaaagtc
gccgatgagattgatgatgtcatgtttggatccattcacacagcagaagctgcagcggaa
tctgatatcgcagaaaacacagtcactgtattcaagcagtttgacgagggtcgtgcggat
tatgatggcgctgtcactgacggagatttacttaacaagtttgtcaaagaaaaccaactt
agattggtgactgagttcacttcagagagtgctccaaagatctttggaggagacatccag
atccacaatcttctcttcatcccaaaattgagccaggaatctcaggatcatctcactgct
ttcactgaagctgccaaacaattcaaaggaaaagttttgttcatctacatcgacactgac
agcgaagaaaacaagagagtcatggaattcttcggtttgactgacgcagacatccctgat
tatagaatcatcaagatgtccgagaacatggccaagttcaagcccgacaccaaagagctc
accaccgaagcaatcgctgcattcaccaacaaagttgtcacaggagaagttcagcgtcac
ttaatgagtgctgagatccctgatgattgggataagaacccagtcactgttcttgttgga
aagaactttgaacaagttgcttatgacaagaagaagaaggttttcgttgaattctacgcc
ccatggtgtggtcactgcaagtcgcttgccccaacctgggacaaacttggtgagaaatac
agcgacaatgctgacgttgtaatcgccaagatggactcgacagcaaacgaactttcccag
ttcgaaatcagtggtttcccaaccctcaagttcttccccgaagttgccgaaggagaagaa
caaaaagttctggactatgatggtgatcgtactgtggaagcaatggctgctttcattgat
tccaacggagagaaaggaaatgttgctaccaagccactgccaccaaaagagactgaacca
ccggcagatttcaatccaaaccagattaaagatgacatgcacaaggagctggaagatgtt
gttcctaagggagacccgaaagagatgttggaaaaacaagcagaaaaggaaaaacaggaa
aagcagaaaactgccgagccgaaagagggcgagaaaagggttcctcaacctgaacctaaa
aagggaaaagagaaaaaagaactttaa

DBGET integrated database retrieval system