KEGG   Ciona intestinalis (sea squirt): 100182410Help
Entry
100182410         CDS       T01056                                 

Definition
dihydrofolate reductase-like
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cin00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    100182410
   00670 One carbon pool by folate
    100182410
Enzymes [BR:cin01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     100182410
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
6
AA seq 194 aa AA seqDB search
MPAKDIKIHSVVACCNNGGIGFKGRLPWRLPKEMKYFKRITTGEVEEFGGRRNVVIIGRK
TWESIPKSFKPLKDRINIVISRTLDKDCEGPDLVVNSLDELIDLLHSKPWCDKINQVFNI
GGNEIYKLIHNSQYCGKIYLTRVLADLQCDTFLENLDDNFTKLPTEGFPEVPQGIQMDKN
DLQWKVEVYEKKTT
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgccagcaaaagacattaaaatacattctgtggttgcttgttgtaacaatggtggaatt
ggatttaaaggtcgtttaccatggagattgcccaaagagatgaaatatttcaagaggatc
accacaggagaagtggaggagtttggtggaaggagaaacgtcgtcatcattgggaggaaa
acatgggagtcaatcccaaagtcctttaaacctttaaaagatcgaataaacatcgttatt
agtcggactttagataaagattgtgaaggcccagatcttgtcgtcaactcattagatgaa
ctgattgatcttcttcattctaaaccatggtgtgataagatcaaccaagtttttaacatt
ggaggaaatgaaatatataagttaatccacaactctcagtattgtggtaagatttatcta
acaagagtactggctgacctccaatgtgacacattccttgaaaatttggatgataatttc
accaagctgcctactgaaggatttccggaagtcccacaaggcattcagatggacaagaat
gatctgcagtggaaagtagaggtttatgaaaagaaaactacttga

DBGET integrated database retrieval system