KEGG   Ciona intestinalis (sea squirt): 100182424Help
Entry
100182424         CDS       T01056                                 

Gene name
gpx7
Definition
glutathione peroxidase 7 (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:cin00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:cin00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
9
AA seq 190 aa AA seqDB search
MAREVLRVLVLLAPLFGVFSENKHNGFYDYNVKTFDGETVSLKKYIGKVSLVVNVASECG
YTDEHYKELTALQNELVQKEQPFTVLAFPCNQFGEQEPHDNHYIQEFASSEYKASFPIFA
KIDVRDRDAHPAYEFLRRSTGQEPQWNFWKYLLDGSGNVINEWGPSISVSQVKDEILKAI
QKLKNTHAEL
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggcaagggaggttctgcgggttttggttttgttggccccactgtttggtgtgtttagt
gagaataagcacaatggattttacgattacaatgtaaaaacttttgacggggaaacagtt
tccttgaagaaatacatcggaaaggtttcactcgttgttaatgttgccagcgagtgcggg
tacacagacgaacattacaaggaactaactgcactgcagaatgagcttgtgcaaaaggaa
cagccgttcacagtccttgctttcccgtgtaatcagttcggagaacaagaaccacacgac
aaccattatatacaggagtttgcaagcagcgaatacaaagctagctttcctattttcgcc
aagatagacgtgagagacagagacgcgcatcctgcatacgaattcttgagaagaagcacg
gggcaagaacctcagtggaacttctggaaatatttgctggacggatcgggcaacgtgata
aatgagtgggggccatccataagtgttagccaagtgaaggacgaaattctaaaagcaatt
caaaaattgaagaacactcacgcggagttataa

DBGET integrated database retrieval system