KEGG   Ciona intestinalis (sea squirt): 100182424Help
Entry
100182424         CDS       T01056                                 

Gene name
gpx7
Definition
glutathione peroxidase 7 (EC:1.11.1.9)
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:cin00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    100182424 (gpx7)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    100182424 (gpx7)
Enzymes [BR:cin01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     100182424 (gpx7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
9
AA seq 190 aa AA seqDB search
MAREVLRVLVLLAPLFGVFSENKHNGFYDYNVKTFDGETVSLKKYIGKVSLVVNVASECG
YTDEHYKELTALQNELVQKEQPFTVLAFPCNQFGEQEPHDNHYIQEFASSEYKASFPIFA
KIDVRDRDAHPAYEFLRRSTGQEPQWNFWKYLLDGSGNVINEWGPSISVSQVKDEILKAI
QKLKNTHAEL
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggcaagggaggttctgcgggttttggttttgttggccccactgtttggtgtgtttagt
gagaataagcacaatggattttacgattacaatgtaaaaacttttgacggggaaacagtt
tccttgaagaaatacatcggaaaggtttcactcgttgttaatgttgccagcgagtgcggg
tacacagacgaacattacaaggaactaactgcactgcagaatgagcttgtgcaaaaggaa
cagccgttcacagtccttgctttcccgtgtaatcagttcggagaacaagaaccacacgac
aaccattatatacaggagtttgcaagcagcgaatacaaagctagctttcctattttcgcc
aagatagacgtgagagacagagacgcgcatcctgcatacgaattcttgagaagaagcacg
gggcaagaacctcagtggaacttctggaaatatttgctggacggatcgggcaacgtgata
aatgagtgggggccatccataagtgttagccaagtgaaggacgaaattctaaaagcaatt
caaaaattgaagaacactcacgcggagttataa

DBGET integrated database retrieval system