KEGG   Ciona intestinalis (sea squirt): 100182564Help
Entry
100182564         CDS       T01056                                 

Definition
n,N'-diacetylchitobiase-like
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:cin00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    100182564
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    100182564
   00603 Glycosphingolipid biosynthesis - globo series
    100182564
   00604 Glycosphingolipid biosynthesis - ganglio series
    100182564
   00511 Other glycan degradation
    100182564
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100182564
Enzymes [BR:cin01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     100182564
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
10
AA seq 886 aa AA seqDB search
MLRVSLNYKGLVGLCIFSLFIVYYLMKNTSQFSKDIKYTMNPMLDYMGANLEVRYKTGPN
YGADKFIHEVTIINSGDQDIPHEGWSIYFNSLHLIEFDTLKKNREYSLPLCDFIITHMDG
GFFKLTPDQNFKGIPAGGAALIKFRSYQTASRSYILPRWYVSAPDHAPVIIQSTDDEDVK
FVEGFNKMEKWKRSSDDNADPFTPQERFARDRIEDLVVAPMKVLPTPIHFNVNSKKIMVL
DSSKWCVCCTNLPSNIQNEAKRIADILGVQHIPGSEPCPPSQVIKIIVADVEGVPSSNEA
YMIKIDDSRETIIITAPHEAGIFYAGQTLLSLAERNGSFQLSFPTGTIQDGPRYGYRGLH
IDVARNFVPADEIIKIIEVRVGCTMALYKLNKLHFHLTDDEGWRIEINGLPELTQIGAVR
CHTETEDTCLFPALGSGPNKDTSGSGFYTADDYKRILQSAVANHVQVIPEVDTPGHSHAA
INAMEVRYREFNLRGDTAAADEFRLIDPDDVSTAMSVQHFRNNALNPCIASSYKFVEKVI
TEIKALHADIQPLTTIHMGGDEVAKKSWEGSPVCEKFISEEEGFPYSNVDLQEYFIRKVS
DICTKHGLNLGVWEDGALKSPDTVPYEKSSIPCDVLAYSWNNAGWSPYLANRAYKLANAG
YKVVMSQATHFYFDHPHEPDPEEIGLFWATRYIDDRKVFEFMPEHLYSNAKFNLNAEPFS
SEEVKNMRDTNLPLTAPENIIGMQAAVWSEMLRDVTKFHYQLFPRLIAFAERAWHKAPWE
AEQANEWTKLQDWRDFVNVVGYKELSRLRIRNIHYRLPPPGVRITDDGKIEICSKFPGLT
FKFRTVSGDEHSDWSECVDQQPITDKKAIYEFVTTDGQRQSRIIRL
NT seq 2661 nt NT seq  +upstreamnt  +downstreamnt
atgctcagagtgagcctcaactacaaaggtcttgttggtctgtgtatattttcgctcttt
atcgtttactacttgatgaaaaatacgtctcaattttcgaaggacataaaatacactatg
aatccaatgcttgattacatgggtgctaacttggaggtgcgatataagactggaccaaat
tatggggcagacaaatttattcatgaagtgacaataataaacagcggagaccaagatatt
cctcacgaaggctggtcaatctactttaacagtctccaccttattgagttcgacaccttg
aagaaaaaccgagaatattcacttcctctgtgtgacttcattatcacacacatggatggt
ggattctttaaactaacacctgatcaaaactttaaaggcatcccagctggaggagcagct
ctcatcaagttccggagctaccaaaccgcatcccgatcctacatcctcccacgatggtac
gtgtctgctcctgatcacgctcctgtgattatccagagcacagatgacgaagatgtgaag
tttgtggagggtttcaacaaaatggagaagtggaaacgatctagtgatgataacgctgat
ccattcactccacaagaaagatttgccagagatcgcatagaagacttagtagttgcgccc
atgaaagtacttcctactccaatacacttcaatgtaaattctaagaaaataatggtctta
gacagcagtaaatggtgcgtgtgttgcaccaatctaccttccaacatacagaatgaagca
aagagaatagcggatattctcggtgttcaacatataccaggttcagagccctgtccgccc
agtcaagtcatcaaaataatagttgctgatgtagaaggggtacctagttcaaatgaggct
tatatgataaagattgatgattcaagagagaccattataatcacggcaccacacgaagct
gggatattttacgccggacaaactcttctttcattggccgagagaaatggaagttttcag
cttagttttccaacgggaacaatccaggatggtccaagatatggatacaggggtttacac
atcgatgtcgctcgtaactttgttcctgctgatgaaattattaaaattattgaggtcaga
gttggttgtacgatggcgctatacaagctaaacaaacttcatttccatctaaccgatgac
gaaggttggagaattgaaatcaatggattgcctgaactcacacagattggtgctgtcagg
tgccacacagaaacagaggacacttgtttattcccagctcttggctctggacccaacaaa
gatacatcgggcagtggtttctacacagcagatgattataaacgtatattacaaagtgcg
gtcgccaatcatgtacaagttattcctgaggttgatacacctggtcattcacatgccgcg
attaatgccatggaagtcagatatagagaatttaatcttcgtggtgacacagcagcagct
gacgagttccgcttgatcgaccctgatgatgtttccacggcgatgtctgttcaacatttc
cgtaacaacgcacttaacccctgcatagcttcgtcatacaagtttgtggagaaagtcatc
accgagattaaagctcttcacgctgatatacaacctcttaccacaatacacatgggaggg
gatgaggttgctaagaagtcttgggagggttctcctgtatgtgagaagtttatcagtgaa
gaagaagggttcccatatagcaatgttgacctacaggaatatttcattcgtaaagtttcc
gacatttgtaccaaacatggattaaacctaggagtttgggaggatggtgctttgaaatca
ccagacactgttccttatgagaaatcctccataccctgtgatgtgcttgcttattcatgg
aacaacgctggttggagtccttacttagctaatagagcttataaacttgctaatgcaggt
tataaggttgtgatgtcacaagccacccatttttacttcgaccacccccatgaaccagat
cctgaagagatcggtttattctgggcaacgcgttatattgatgatcgtaaagtgtttgag
ttcatgccggaacatctttactcaaatgcaaagttcaacttaaatgctgaaccattttca
tctgaagaagtgaaaaatatgcgagatacaaacctgccactaacagcgccagagaacatt
attggaatgcaggctgctgtgtggtcagaaatgcttcgtgatgtcacaaagtttcattat
caattatttccacgcttgattgcattcgcagagagagcttggcacaaggcaccatgggaa
gcagaacaagcaaatgaatggaccaaactacaagattggagagattttgtaaacgtggtc
ggttacaaggaattatctcgactcaggattcgaaatattcactacagattaccaccacca
ggtgtcagaataacagatgatgggaaaattgaaatttgctctaaattcccgggtctcact
ttcaagtttagaactgtttctggtgacgaacattctgattggtcagaatgtgtggaccaa
cagccaatcacagacaagaaagcgatatatgaattcgtaaccacagatggtcaaagacag
agccgaattattcgattatga

DBGET integrated database retrieval system