KEGG   Ciona intestinalis (sea squirt): 100182760Help
Entry
100182760         CDS       T01056                                 

Definition
glutaminase kidney isoform, mitochondrial-like
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:cin00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:cin00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:cin00471]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 508 aa AA seqDB search
MWLRKTNICVLFNQEYLKLKGMYASQYLPFKHARVFSYVQQSVVNSQRNHITGTAAAAEA
SSLIYQILSNGKKTLALRHLKEKLNGNGILWNDPRLKQLHQNIQDWQSNNLHHENETINT
SITADTFLHFLKDEVTLKLFCKVFSKGCVIPNFKKFTEIIADCFETAKKSQHGKVADYIP
QLAKADPESWGLSICSVDGQRFSIGDANESFCLQSCVKPFVYAIAVSDYSSEMIHRYMGQ
EPSGLYFNALNLNTEDKPHNPLINSGAIVVCSLIKPDQLLSERFEYVQKYLRDMCADEHV
SFDNTVFLSEKQTSFQNFSIAYYLMEKNCFPVNTSLRTTLDFYLQLCAVTTTCQSAAVAA
STLANGGVSPLLQNKDRLLQPASVRNTLSLMHSCGMYDYSGKFAFQVGLPAKSGVAGGLL
VVIPNVMGFMCRSPLLDDKGNSVRGIEFCRELVRTFNFHTYDDLLHSVKKKDPRKLNRLL
TSDEMRLSYLYKVMYEYDSETDDSIQHD
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgtggttgagaaagacaaacatctgtgtgctatttaatcaagagtacctcaaactcaag
ggcatgtacgcttctcagtatttgccgtttaaacatgctcgtgtttttagttatgttcag
caatcggtagttaactctcaacgcaaccacatcactggaacagctgctgcagcagaagca
agctcattaatttaccaaatcctaagcaatggaaagaaaactcttgcattacgccactta
aaagagaaattaaatggcaatggaatattgtggaatgatccaagattaaaacagcttcac
caaaacattcaagattggcaatcaaataatcttcatcatgagaatgagacaattaacaca
agtatcactgctgacacttttctacattttctaaaagacgaagtaactttaaagttattc
tgcaaagtgttttcaaaaggttgtgttattccaaactttaaaaagttcacagagataatt
gctgattgttttgaaacagctaaaaaaagtcaacatggaaaggtggccgattatattcct
caacttgcgaaagccgacccggagtcttggggattgtctatttgctctgtggatggacaa
aggttttcaattggtgatgcaaatgaatcattttgtttacaatcttgtgtgaagcccttt
gtttatgcaatcgcagtctctgattacagttctgaaatgattcatcgttacatggggcag
gaacctagtggactttattttaatgcactaaacttgaatactgaagacaagccacataat
cctttaataaattctggagctattgttgtatgttcccttattaaaccagatcagctgcta
tcagaaagatttgaatatgttcaaaagtatttacgagatatgtgcgccgatgaacatgtc
tcatttgacaacactgtgtttttatctgagaagcaaacttcatttcaaaatttttcaatt
gcctactacttgatggagaaaaattgtttccctgtgaatacttcacttcgtacaacactt
gacttctatcttcaactttgtgctgtaacaactacttgtcaaagtgctgccgttgctgct
tcaaccctagcgaatggaggtgttagtcctttgttgcaaaacaaagatcgattgttacaa
ccagcatccgttcgtaacacactgtcattaatgcattcttgtggaatgtacgactattct
ggaaagtttgcatttcaggttggcttaccagcaaaatctggtgtagcaggggggttactt
gttgttattccaaatgtaatgggatttatgtgtagaagcccgctactggatgataaagga
aattctgttcgaggtattgagttctgtcgagaacttgtgaggacattcaattttcatacg
tatgatgatcttttacattcagtaaagaaaaaggacccaagaaaactaaacagactgtta
acaagtgatgagatgagattaagttatctttataaggtaatgtatgaatatgattccgag
acagatgatagcattcagcatgactga

DBGET integrated database retrieval system