KEGG   Ciona intestinalis (sea squirt): 100182767Help
Entry
100182767         CDS       T01056                                 

Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit B-like
  KO
K03253  translation initiation factor 3 subunit B
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
cin03013  RNA transport
Brite
KEGG Orthology (KO) [BR:cin00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100182767
Messenger RNA biogenesis [BR:cin03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     100182767
Translation factors [BR:cin03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    100182767
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF2A RRM_1 Alginate_lyase2 Nup35_RRM_2
Motif
Other DBs
NCBI-GeneID: 100182767
NCBI-ProteinID: XP_002130037
Ensembl: ENSCING00000003620
UniProt: A0A1W2WF12
Position
3
AA seq 699 aa AA seqDB search
MVTSMDGEQDWEDVKPRKKRQDDIINGSEEEPDFSDPEDFEEDVSDSEFLADVLEKKPKE
ADGIDAVIVVDNVPVVGEERLGKLKIVITKIFSKFGKIHSDYYPEFEGKTKGYIFIEYEQ
DKSAKDAVKGADGYKLDKSHAFRVNLFSDFEKYKNVTENWTPPEKQPLKDVGNLYYFLED
EDCNNQFSVIYEGGVKTGIFLNTAAEPSLLEQRERWTETYTRWSPKGAYLATFHAKGIAL
WGGEKFRQIQRFTHPGVQLIDFSPCERYLVTFSPMQDPSRGDDIQAITVWEIFTGLKKRS
FHADMSGEDRQWPIFKFVSYDGKYFARKAKGVLSVYETPSMGLVDKKSIAIDGISEFFWS
PADNMLAFWIPENNQIPARVTILAIPSKKEVRVKNLFNVSDIRLNWHKQGKFLCVKVDRY
NKAKKANISNFEIFHIMEKQVPVDIVELKEQVIAFAWEPTGNKFCCLHGEAPRISAMFFE
IKGGKIEHLGTMEKKQATHIFWSPAGQFVLLVGLNSSSQLEFIDTADMTVMNSGEHHMVS
DVEWDPTGRYLVSIVSWWEHKIDNAYWVWSFQGRLMRKYPMEQLCQLLWRPKPKSILSAD
HIKKIRKNHKSFSKIFEAKDRLLQSRVSKEIIDKRRSLMEEFTNYRKHCNEVYQHTTPYR
RELRNGVMTDEVDYQAEDLDEVTVEILIEEEETILNDKE
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atggtaacgagcatggacggtgagcaagattgggaagacgtaaaaccgcgtaaaaagcgc
caggatgatataataaacggcagcgaggaagagccagactttagcgatcccgaagatttt
gaagaggatgtttcggattcggagtttttggccgatgtgctcgaaaaaaagccgaaagaa
gctgacggtatagacgcagtgattgttgttgacaatgttcccgtagtgggagaagaaaga
cttggaaagttgaagatagttattacaaaaatattttcaaagtttggaaagattcacagt
gactattatccagagttcgaaggaaaaacaaaaggatacattttcattgaatatgaacaa
gacaaatcagccaaggatgcggtcaaaggagcagacggatacaaacttgataaatcgcac
gcttttagagtgaatttgttcagtgactttgaaaagtacaaaaatgtaactgaaaattgg
accccgccagaaaaacaaccattgaaggacgtgggaaatctttactactttcttgaagat
gaagattgtaacaatcaatttagtgtaatatatgaggggggtgtgaagacaggtatcttt
ctgaacacagcagctgaaccaagccttttagaacaacgagaacgttggacagaaacttac
acgcgttggtcaccaaaaggggcgtacctcgctactttccatgctaaaggtatcgcgttg
tggggtggtgaaaagtttcgccaaatccaacgttttacccatccaggggttcaactcatt
gatttttctccatgtgaaaggtatttagttaccttcagtccaatgcaagaccccagcaga
ggggatgatatccaagccattactgtgtgggaaatatttaccgggttgaaaaagagaagt
ttccacgctgacatgtctggtgaggacagacagtggccaattttcaaatttgtatcttat
gatggaaagtattttgcaaggaaagcaaaaggagttctgagtgtatatgaaacaccgtca
atgggcttagtggataaaaagagcattgctattgatggaatcagcgagttcttctggtct
cctgctgacaacatgttggcgttttggattcctgaaaacaaccagataccggccagagtg
accattcttgcaattccttccaagaaagaagtccgcgtgaaaaacttattcaatgtttct
gatattcgcctcaactggcacaaacaaggaaagttcctttgtgtgaaggtggacagatac
aacaaagccaaaaaggccaatatttccaattttgaaatctttcatataatggagaagcaa
gtgccagtcgacatagttgaactcaaagaacaggtaattgcttttgcatgggaacctact
ggtaacaaattctgctgtctgcacggagaagcacctagaatatcagcaatgttctttgaa
attaaaggagggaaaatagaacatctcggaactatggaaaagaaacaagctacacatata
ttctggtcacctgctggacaatttgtgcttctggttggattgaacagttcaagtcaactg
gagttcatcgacactgccgacatgacagtaatgaacagtggtgagcatcatatggtatcg
gatgtagagtgggatcctactggaagatatcttgtctccattgttagctggtgggaacat
aagattgacaatgcttactgggtgtggtcattccaaggaaggcttatgaggaaatatccc
atggaacaattatgccaactactgtggagaccaaaaccaaaatccattctctctgctgat
catattaagaaaatccgtaagaatcacaagtcctttagcaagatctttgaagcaaaggac
agacttcttcagagccgtgtttccaaagaaattatcgacaaacgtagatcgttgatggaa
gagtttaccaactacagaaaacattgcaatgaagtttatcagcacacaactccatataga
agagaactaagaaatggtgttatgactgatgaagttgactaccaggctgaagatctagat
gaagtgactgttgaaattttaattgaggaagaagaaactattttgaacgataaggagtaa

DBGET integrated database retrieval system