KEGG   Ciona intestinalis (sea squirt): 100182767Help
Entry
100182767         CDS       T01056                                 

Definition
eukaryotic translation initiation factor 3 subunit B-like
Orthology
K03253  
translation initiation factor 3 subunit B
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
RNA transport
Brite
KEGG Orthology (KO) [BR:cin00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100182767
Translation factors [BR:cin03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    100182767
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
3
AA seq 699 aa AA seqDB search
MVTSMDGEQDWEDVKPRKKRQDDIINGSEEEPDFSDPEDFEEDVSDSEFLADVLEKKPKE
ADGIDAVIVVDNVPVVGEERLGKLKIVITKIFSKFGKIHSDYYPEFEGKTKGYIFIEYEQ
DKSAKDAVKGADGYKLDKSHAFRVNLFSDFEKYKNVTENWTPPEKQPLKDVGNLYYFLED
EDCNNQFSVIYEGGVKTGIFLNTAAEPSLLEQRERWTETYTRWSPKGAYLATFHAKGIAL
WGGEKFRQIQRFTHPGVQLIDFSPCERYLVTFSPMQDPSRGDDIQAITVWEIFTGLKKRS
FHADMSGEDRQWPIFKFVSYDGKYFARKAKGVLSVYETPSMGLVDKKSIAIDGISEFFWS
PADNMLAFWIPENNQIPARVTILAIPSKKEVRVKNLFNVSDIRLNWHKQGKFLCVKVDRY
NKAKKANISNFEIFHIMEKQVPVDIVELKEQVIAFAWEPTGNKFCCLHGEAPRISAMFFE
IKGGKIEHLGTMEKKQATHIFWSPAGQFVLLVGLNSSSQLEFIDTADMTVMNSGEHHMVS
DVEWDPTGRYLVSIVSWWEHKIDNAYWVWSFQGRLMRKYPMEQLCQLLWRPKPKSILSAD
HIKKIRKNHKSFSKIFEAKDRLLQSRVSKEIIDKRRSLMEEFTNYRKHCNEVYQHTTPYR
RELRNGVMTDEVDYQAEDLDEVTVEILIEEEETILNDKE
NT seq 2100 nt NT seq  +upstreamnt  +downstreamnt
atggtaacgagcatggacggtgagcaagattgggaagacgtaaaaccgcgtaaaaagcgc
caggatgatataataaacggcagcgaggaagagccagactttagcgatcccgaagatttt
gaagaggatgtttcggattcggagtttttggccgatgtgctcgaaaaaaagccgaaagaa
gctgacggtatagacgcagtgattgttgttgacaatgttcccgtagtgggagaagaaaga
cttggaaagttgaagatagttattacaaaaatattttcaaagtttggaaagattcacagt
gactattatccagagttcgaaggaaaaacaaaaggatacattttcattgaatatgaacaa
gacaaatcagccaaggatgcggtcaaaggagcagacggatacaaacttgataaatcgcac
gcttttagagtgaatttgttcagtgactttgaaaagtacaaaaatgtaactgaaaattgg
accccgccagaaaaacaaccattgaaggacgtgggaaatctttactactttcttgaagat
gaagattgtaacaatcaatttagtgtaatatatgaggggggtgtgaagacaggtatcttt
ctgaacacagcagctgaaccaagccttttagaacaacgagaacgttggacagaaacttac
acgcgttggtcaccaaaaggggcgtacctcgctactttccatgctaaaggtatcgcgttg
tggggtggtgaaaagtttcgccaaatccaacgttttacccatccaggggttcaactcatt
gatttttctccatgtgaaaggtatttagttaccttcagtccaatgcaagaccccagcaga
ggggatgatatccaagccattactgtgtgggaaatatttaccgggttgaaaaagagaagt
ttccacgctgacatgtctggtgaggacagacagtggccaattttcaaatttgtatcttat
gatggaaagtattttgcaaggaaagcaaaaggagttctgagtgtatatgaaacaccgtca
atgggcttagtggataaaaagagcattgctattgatggaatcagcgagttcttctggtct
cctgctgacaacatgttggcgttttggattcctgaaaacaaccagataccggccagagtg
accattcttgcaattccttccaagaaagaagtccgcgtgaaaaacttattcaatgtttct
gatattcgcctcaactggcacaaacaaggaaagttcctttgtgtgaaggtggacagatac
aacaaagccaaaaaggccaatatttccaattttgaaatctttcatataatggagaagcaa
gtgccagtcgacatagttgaactcaaagaacaggtaattgcttttgcatgggaacctact
ggtaacaaattctgctgtctgcacggagaagcacctagaatatcagcaatgttctttgaa
attaaaggagggaaaatagaacatctcggaactatggaaaagaaacaagctacacatata
ttctggtcacctgctggacaatttgtgcttctggttggattgaacagttcaagtcaactg
gagttcatcgacactgccgacatgacagtaatgaacagtggtgagcatcatatggtatcg
gatgtagagtgggatcctactggaagatatcttgtctccattgttagctggtgggaacat
aagattgacaatgcttactgggtgtggtcattccaaggaaggcttatgaggaaatatccc
atggaacaattatgccaactactgtggagaccaaaaccaaaatccattctctctgctgat
catattaagaaaatccgtaagaatcacaagtcctttagcaagatctttgaagcaaaggac
agacttcttcagagccgtgtttccaaagaaattatcgacaaacgtagatcgttgatggaa
gagtttaccaactacagaaaacattgcaatgaagtttatcagcacacaactccatataga
agagaactaagaaatggtgttatgactgatgaagttgactaccaggctgaagatctagat
gaagtgactgttgaaattttaattgaggaagaagaaactattttgaacgataaggagtaa

DBGET integrated database retrieval system