KEGG   Ciona intestinalis (sea squirt): 100182788Help
Entry
100182788         CDS       T01056                                 

Definition
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase 1-like
Orthology
K00731  
glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase [EC:2.4.1.122]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Mucin type O-Glycan biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cin00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    100182788
Enzymes [BR:cin01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.122  glycoprotein-N-acetylgalactosamine 3-beta-galactosyltransferase
     100182788
Glycosyltransferases [BR:cin01003]
 Glycan extension
  Type 3 chain
   100182788
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
11
AA seq 273 aa AA seqDB search
MSVQYVACQVQTAESTAKNISNVRVLCWVMTSPMTLFTKAVHVRDTWGRRCDKILFMSSE
DNEKLPAIGLGVKEGREHLYDKTAAAFQYIWTHHKDEADWFLKADDDTYVIIENLKLLLK
DHDPYLPMYFGRKFTPMVKQGYMSGGAGYVLSKAALSRFDRATRTQRCIPLDSNEDLEIG
RCMQHIGVKTMDSRDPEKKETFFPFSPALHILPGNIPKDSWYWKYIAHPNPSGPGCCSKH
MISFHYVQPDMMHIIHHFIYRMEAYGVKAQSYV
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtacaatatgtggcttgtcaggttcaaactgcagaatcgacagcaaaaaacatc
agcaatgttcgtgtcttgtgctgggtgatgacatcaccgatgacgttgtttacgaaagct
gtgcatgtgagggatacttgggggagaagatgtgataaaatattgttcatgagctcggaa
gataacgagaaattgccagctatcgggttaggcgtaaaggaaggtagggaacatctttat
gataaaacagcagctgcgtttcagtatatttggacgcatcataaagatgaagcggattgg
ttcctcaaagctgatgatgatacttatgttataattgaaaatttaaagttgttgttaaag
gaccacgacccatacttgcccatgtattttggtcgtaagtttacaccaatggttaaacaa
ggttacatgagcgggggggctggttatgtattgagtaaagctgcactaagtagatttgat
cgcgcaactcgtacacaaagatgtatcccccttgattctaatgaagatttagaaattggt
cgatgtatgcaacacattggggtaaaaaccatggattcgagagatccagagaagaaggaa
accttttttcctttctctcctgcattgcatatcttaccaggaaacataccaaaagatagc
tggtattggaagtacatagctcaccccaacccttctggtcccggatgttgctctaaacat
atgatttcgtttcattacgtacaaccagatatgatgcacataatacatcactttatatac
cgtatggaggcgtatggtgtcaaagctcaaagttacgtttaa

DBGET integrated database retrieval system