KEGG   Ciona intestinalis (sea squirt): 100182816Help
Entry
100182816         CDS       T01056                                 

Definition
dual specificity protein kinase CLK2-like
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
cin  Ciona intestinalis (sea squirt)
Brite
Enzymes [BR:cin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     100182816
Protein kinases [BR:cin01001]
 Serine/threonine protein kinases: CMGC group
  CLK family
   100182816
Spliceosome [BR:cin03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    100182816
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
4
AA seq 502 aa AA seqDB search
MTVTRMGKTSRRYRSRENDENYKYGQKRRRVEKYDDYYEDTYGPKRCNDSYSCEKHSYSS
QSGKHYQSSYNDGYYSRDSSRTLNSRQKNEDSRDRHDYSGSSRRRRSRHRKHKSRSSHSR
DRHRNKNGGRAKSVEDDEEGHLIYRHGDCLQARYEILSTLGEGTFGKVLLCLDHQRGGKK
VALKVIKNIEKYRDAAFLEINVLKKLQEKDPVGKYLCVTMLDWFNYHGHICLAFELLGLS
TYDFQKDNHYIPYPLDQVRHMAFQLVWAVKFLHDNHITHTDLKPENILFRDSLCELRYNP
SKRRDERQLVSSDIRLIDFGSATFDNEHHSTVVSTRHYRAPEVVLELGWNQSCDVWSIGC
IIFEFYMGITMFQTHDNREHLAMMERILGPIPSRMIKKSRKQKYFYHNRLDWDEHSSGGK
YVRENCKPIMRYIQRKDHPEHMKLIDLIARMLEYDPTKRISLAEAINHSFFDELPHEKRF
PNNHTNQSSYETNTRCLRSAGR
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgactgttacaagaatgggaaaaaccagtcggcggtatcgcagtcgagaaaatgatgaa
aactacaagtatggtcagaaacgaagacgagtggaaaagtatgatgattattatgaagat
acttatggacccaaacgatgcaatgattcctattcatgtgaaaagcatagctacagctcc
caaagtggcaagcactaccaaagcagctacaatgatggatactacagtcgtgattcaagc
aggactttaaactcccgtcagaagaatgaggactccagagatcgacatgactattctggc
agcagtcggagacggagaagtcgacatagaaaacataagtctcggtcttctcattcgaga
gatcgtcatagaaacaagaatggtggcagggcaaagagcgtggaagatgacgaggagggt
catctgatttatcgtcatggcgactgtcttcaagcgagatatgaaatcctgtctacgctt
ggagaaggcactttcggaaaggttctgctctgccttgatcaccaaaggggtggtaagaaa
gtggctttaaaggtgatcaaaaatattgagaagtatcgcgatgctgcttttctggagata
aatgttcttaaaaagcttcaagaaaaggatcctgttggaaaatacctctgtgtaaccatg
ttggattggttcaactaccatggtcatatctgcctggcatttgaactgcttggtttaagt
acctatgactttcagaaggacaatcactacattccatatcccctggaccaagtgcgacac
atggcctttcaattagtatgggctgtaaaatttctccatgacaatcatatcacacacact
gatctgaaacctgagaatattcttttccgtgattctttatgtgagttgcgttacaatcca
tccaagcgaagagatgaaaggcagttggtcagttccgatatccgattgattgatttcggg
tcagccacctttgacaatgagcatcatagtacagttgtatctacccgacactacagggca
cctgaagttgtattagaacttggttggaaccaatcctgtgacgtgtggtctattggttgt
attatatttgagttctacatgggaattaccatgttccaaactcatgataatcgagagcat
ctagcaatgatggagcgtattcttggtcctattccaagtcgcatgattaaaaaatcccgt
aaacagaagtatttctatcacaaccgtctcgattgggacgaacattcttctggtggaaaa
tatgtgagagaaaactgcaaacctataatgaggtatattcaacgtaaagatcacccggag
cacatgaagttaattgatttaatcgcacgaatgctggagtatgatccaactaaacgtatt
tcacttgctgaagcaatcaaccattcattctttgatgaactaccccatgaaaaacgtttc
ccaaataatcacaccaaccaatcatcttatgaaacaaatactcggtgtttacgatctgct
ggtcgttga

DBGET integrated database retrieval system