KEGG   Ciona intestinalis (sea squirt): 100182816Help
Entry
100182816         CDS       T01056                                 

Definition
dual specificity protein kinase CLK2-like
Orthology
K08823  
CDC-like kinase [EC:2.7.12.1]
Organism
cin  Ciona intestinalis (sea squirt)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
4
AA seq 502 aa AA seqDB search
MTVTRMGKTSRRYRSRENDENYKYGQKRRRVEKYDDYYEDTYGPKRCNDSYSCEKHSYSS
QSGKHYQSSYNDGYYSRDSSRTLNSRQKNEDSRDRHDYSGSSRRRRSRHRKHKSRSSHSR
DRHRNKNGGRAKSVEDDEEGHLIYRHGDCLQARYEILSTLGEGTFGKVLLCLDHQRGGKK
VALKVIKNIEKYRDAAFLEINVLKKLQEKDPVGKYLCVTMLDWFNYHGHICLAFELLGLS
TYDFQKDNHYIPYPLDQVRHMAFQLVWAVKFLHDNHITHTDLKPENILFRDSLCELRYNP
SKRRDERQLVSSDIRLIDFGSATFDNEHHSTVVSTRHYRAPEVVLELGWNQSCDVWSIGC
IIFEFYMGITMFQTHDNREHLAMMERILGPIPSRMIKKSRKQKYFYHNRLDWDEHSSGGK
YVRENCKPIMRYIQRKDHPEHMKLIDLIARMLEYDPTKRISLAEAINHSFFDELPHEKRF
PNNHTNQSSYETNTRCLRSAGR
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgactgttacaagaatgggaaaaaccagtcggcggtatcgcagtcgagaaaatgatgaa
aactacaagtatggtcagaaacgaagacgagtggaaaagtatgatgattattatgaagat
acttatggacccaaacgatgcaatgattcctattcatgtgaaaagcatagctacagctcc
caaagtggcaagcactaccaaagcagctacaatgatggatactacagtcgtgattcaagc
aggactttaaactcccgtcagaagaatgaggactccagagatcgacatgactattctggc
agcagtcggagacggagaagtcgacatagaaaacataagtctcggtcttctcattcgaga
gatcgtcatagaaacaagaatggtggcagggcaaagagcgtggaagatgacgaggagggt
catctgatttatcgtcatggcgactgtcttcaagcgagatatgaaatcctgtctacgctt
ggagaaggcactttcggaaaggttctgctctgccttgatcaccaaaggggtggtaagaaa
gtggctttaaaggtgatcaaaaatattgagaagtatcgcgatgctgcttttctggagata
aatgttcttaaaaagcttcaagaaaaggatcctgttggaaaatacctctgtgtaaccatg
ttggattggttcaactaccatggtcatatctgcctggcatttgaactgcttggtttaagt
acctatgactttcagaaggacaatcactacattccatatcccctggaccaagtgcgacac
atggcctttcaattagtatgggctgtaaaatttctccatgacaatcatatcacacacact
gatctgaaacctgagaatattcttttccgtgattctttatgtgagttgcgttacaatcca
tccaagcgaagagatgaaaggcagttggtcagttccgatatccgattgattgatttcggg
tcagccacctttgacaatgagcatcatagtacagttgtatctacccgacactacagggca
cctgaagttgtattagaacttggttggaaccaatcctgtgacgtgtggtctattggttgt
attatatttgagttctacatgggaattaccatgttccaaactcatgataatcgagagcat
ctagcaatgatggagcgtattcttggtcctattccaagtcgcatgattaaaaaatcccgt
aaacagaagtatttctatcacaaccgtctcgattgggacgaacattcttctggtggaaaa
tatgtgagagaaaactgcaaacctataatgaggtatattcaacgtaaagatcacccggag
cacatgaagttaattgatttaatcgcacgaatgctggagtatgatccaactaaacgtatt
tcacttgctgaagcaatcaaccattcattctttgatgaactaccccatgaaaaacgtttc
ccaaataatcacaccaaccaatcatcttatgaaacaaatactcggtgtttacgatctgct
ggtcgttga

DBGET integrated database retrieval system