KEGG   Ciona intestinalis (sea squirt): 100182913Help
Entry
100182913         CDS       T01056                                 

Definition
peroxisomal bifunctional enzyme-like
Orthology
K07514  
enoyl-CoA hydratase / 3-hydroxyacyl-CoA dehydrogenase / 3,2-trans-enoyl-CoA isomerase [EC:4.2.1.17 1.1.1.35 5.3.3.8]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Peroxisome
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:cin00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100182913
   01212 Fatty acid metabolism
    100182913
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100182913
   00650 Butanoate metabolism
    100182913
  Lipid metabolism
   00071 Fatty acid degradation
    100182913
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    100182913
   00310 Lysine degradation
    100182913
   00380 Tryptophan metabolism
    100182913
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100182913
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    100182913
Enzymes [BR:cin01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     100182913
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     100182913
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     100182913
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 731 aa AA seqDB search
MAKYSVENEVAVIAVDNPPMNALSHHVRKSLLKYLKEAESDEKVTSIVLCGDGRTFPVGA
DIKEFHKSVSKLGPTILDIVDALEKSKKPTIAAIHGNALGGGLEIALGCHYRIAMTNSKV
GLPEVKLGILPGAGGTQRLPRVIGLDNAMQWIAYGGHHSAGIGASLGLIDRVVPQGGNIR
EHAILFAKAAVGKSLGQRRLSNISVPDAAKVESLMAKHLKEVSKKSRGALAPIVCLQVIK
SSALLSYQEGLESERQGMFTLLASSQSRAQIYSFFAERQVSKWSVPGVTNYQNAVPMKVK
AVGVVGLGTMGRGIAICCLRAGKITYVLEMNTKAQTAGVKYIRGYIETMRKRKQINDQQS
SMMNNALIPVDNYNGLKNVDLVIEAVFESMKIKKEIFKKLEKVCKPSAILASNTSTLNID
EMASVTKRPQKVAGMHFFAPAHIMMLLENIRGEKSSPETIATIMDLGKQMRKTTVLVGNC
HGFVGNRMFAYYTAESSFLLEEGAYPKQVDDVLLDYGFAMGRFQVGDLSGTDIGYKIRRE
RGLTHKQQPAGTPERKRGDRRYSPLDDFLYEKGRYGLKARKGWYKYEGSRTPIPDPEVRK
MIDDFRKRHNINPRHISPEETLQRMIFPLVNEGFNVLDEGIAANPWDIDMIFQHGYAWPR
HTGGPMYYAYTIGLPQVLKVIEERWKLAGASEPHWKPSKMLTWLVEHHGNPDINDWIKLY
KERKSQPNSNL
NT seq 2196 nt NT seq  +upstreamnt  +downstreamnt
atggccaaatattcagtagaaaatgaagttgctgttatagctgtggataatccacctatg
aatgctttgtctcatcatgtaaggaaatcattattgaaatatttaaaggaagctgaaagc
gatgaaaaagttacttcaatcgtgttatgtggtgatggaaggacattccctgttggagct
gacatcaaagaatttcacaaatcagtctctaaacttggaccaacaatattagatattgta
gatgcattggagaaaagtaagaaaccaacaattgcagcaatccatggaaacgcacttggt
ggaggattagaaattgctcttggatgtcattacagaatagcaatgacaaactcaaaggtt
ggcttacctgaagtaaaacttggtatattacctggtgctggtggaacgcaacgcttacct
cgtgttattggtcttgataatgcaatgcaatggattgcatatggaggtcatcactctgca
gggatcggggcttctcttggtttgattgatcgtgttgtaccacaagggggcaatatcagg
gaacacgcaattttattcgcaaaggctgctgttggaaagagtttaggtcaacgaagactt
tcaaacattagtgttcctgatgcagctaaggttgaatccttgatggcaaaacatttgaag
gaagtaagcaagaaatctcgcggtgctttagctcccattgtgtgtcttcaagttattaaa
agttcggcacttctctcatatcaagagggtttggaatcagaaagacaaggaatgttcacc
cttttggcttcaagtcaatctcgtgctcagatctattccttctttgctgagagacaggtt
tcgaaatggagtgtgcctggtgtaaccaactatcaaaatgctgtcccaatgaaagtgaag
gcagttggagttgttgggttgggaactatgggaagggggattgctatttgttgtcttaga
gcaggaaaaataacttatgtgcttgaaatgaacacaaaagcccaaacagctggggttaaa
tacattcgtggttacatcgaaaccatgagaaaaaggaaacagataaatgaccagcaatct
tccatgatgaataatgctctaattcctgtggataactataatggattgaagaacgttgac
cttgtgattgaagctgtatttgaatcaatgaagattaaaaaagagatatttaaaaaactt
gaaaaagtttgtaaaccttctgccatattagcaagcaatacaagcacacttaatattgat
gaaatggcttctgttaccaagagacctcagaaggttgcggggatgcatttctttgcaccc
gctcatattatgatgttgttggagaatatacgaggggagaagtcttctcctgaaaccata
gcaactattatggacctgggaaagcaaatgaggaaaacaactgtgctggttggaaactgt
cacgggtttgttggtaacagaatgtttgcttattatacggccgaaagttcatttctatta
gaggaaggggcttaccctaaacaggtggatgatgttttgttggattacgggttcgccatg
ggtcgatttcaagttggtgatttatccggaactgacattggatataaaataagaagagaa
cgaggattaacccacaaacaacaacctgccggtactccagaaagaaaaagaggggataga
agatatagtcctttagatgatttcttgtatgagaaaggaagatatggtttgaaagcaagg
aagggctggtataaatatgaaggtagccgaactccaattcctgatcctgaagtgaggaag
atgatagatgacttccgcaaacgtcacaacattaatccacgtcatatttcaccagaggaa
actctgcagagaatgatattccctctcgtcaacgaaggtttcaatgtattagatgaagga
atcgctgctaacccgtgggatattgatatgatatttcaacatgggtatgcatggcctcgc
catacaggtggaccaatgtattatgcttatacaattggtctgccccaagtattgaaggtg
attgaagaaagatggaagttggctggtgcaagtgaaccacactggaagccaagtaagatg
ctcacatggttggttgaacatcatggtaaccctgatattaatgattggatcaaattatac
aaggaaaggaaatcccaacccaacagcaacttgtaa

DBGET integrated database retrieval system