KEGG   Ciona intestinalis (sea squirt): 100183047Help
Entry
100183047         CDS       T01056                                 

Definition
sphingosine kinase 2-like
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:cin00600]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
3
AA seq 575 aa AA seqDB search
MTGDDRNTTTLLSSLFVLYPKKTTAQVTLTNKEVIIEIDQDKNKYTEKISLDDVIGCHVL
EGNHTTGCDWYLCIFSYPLKKKLFKGMIRHRITRSLGIISSKDRNNNKEIAEKWKCVIKY
LISGKTVTKSEVESVVELPSRRYIVYVNPFSGQGKAVEMYNGPVRSMLAEAEVKHKMIKT
KYAGHAKEMVKEVNLSDCDGIIIVSGDGLVHEVINGLMERKDWKTAIKTPIGIVPGGSGN
ALAASVIYASTGQEVSSNIVRDSMFEISRGRWREMSLMQAEMGDRTFYSFLNFGWGFVAD
VDIESEKYRNLGKARFTVGCAVRVANLRKYHGMISYLPHDDVDMFSLNHKTQHQNSLLSV
NNSVKSDSAIMTTAQRNTNYSNANGTSFCKESGDAGACMNRNMSKQKGLCDNYETTDDAA
IIKHTDSTTPKKLQVKPVTPSHKHLKSLNEPLPEGWVSLEDNFVWIMPVYLSHIGHDMLA
MPASKMEDKVIYLYCLKSTVSKMKLAQVLLGFEDGSHLTEGGQHVMVIPCKAFRLEPFCS
HTGYMTVDGELIPHEPLQGQCTDLKAHVICSVGHP
NT seq 1728 nt NT seq  +upstreamnt  +downstreamnt
atgacgggagatgatagaaatacaacaacgctgttgtcatcgctgttcgtcttgtatcct
aagaaaaccactgcacaggttacacttacaaataaagaagtcataatagaaattgaccag
gacaagaataaatatactgaaaaaatatcattggacgatgtaataggttgtcatgtactg
gagggaaaccacaccacaggttgtgattggtacctctgcatattttcctatcctttaaaa
aagaagttgtttaagggaatgataaggcacagaatcacaaggtcactgggtattatttca
agcaaggacagaaacaataacaaagaaatcgcagaaaaatggaaatgtgttatcaagtat
ttaatatcaggaaaaactgtcacaaaatcggaagttgaatctgtggtagaattaccttcg
aggcgatacatagtatatgtcaacccattcagtggacagggtaaagcagtagagatgtac
aatggaccagttcgctcaatgttggcggaagctgaagtaaaacataaaatgattaaaaca
aaatatgctggtcatgctaaggaaatggtaaaagaagtaaacctcagtgattgtgatggc
ataattattgtttctggtgatggcttagttcatgaggtaataaatggtttgatggagagg
aaagattggaagacagcgataaaaaccccaattggaattgttccaggtggatccggtaac
gcccttgctgcctcagttatctatgcctcaacaggtcaggaggtgtcatctaacatcgtg
agggacagtatgtttgaaattagcagaggaagatggagggaaatgtcgttaatgcaagct
gagatgggggatcgaacattctactcattccttaactttggttgggggtttgttgcagat
gttgatattgaaagtgaaaaatacagaaatcttggtaaagcaagatttacagtcggctgt
gctgttcgtgttgcaaaccttcgcaaatatcatggaatgatatcttatttaccacatgat
gatgttgacatgttttctttaaaccataaaacacaacaccaaaattctctgctatcagta
aacaactcagtcaaatcagattcggcaattatgactacagctcaacgcaacaccaactat
agcaacgcaaatggaacaagtttttgcaaagagagtggtgatgcgggtgcctgcatgaac
agaaacatgtcaaagcaaaaaggtctatgtgacaattatgaaacaacagatgatgcagcc
atcatcaaacacacagatagtacaacccccaaaaagttgcaagtaaaacctgtcacccca
tcacataaacatttgaaaagtttgaatgaaccgttgcctgaaggttgggtatcgttagaa
gataactttgtgtggatcatgccggtatatctatcacatattggacatgatatgcttgct
atgccggcttctaagatggaagataaagttatttatttgtattgcttgaaatcaacagtg
agcaaaatgaagctagcgcaagtattgctgggatttgaggacggttctcacctcacagag
ggaggacaacacgtaatggtgattccttgcaaagcttttcgtcttgagcccttctgctct
catactggttatatgactgtggacggagaactgattccacatgaaccattacaaggtcaa
tgtacagatctgaaggcacatgtaatatgcagcgtgggccacccttaa

DBGET integrated database retrieval system