KEGG   Ciona intestinalis (sea squirt): 100183071Help
Entry
100183071         CDS       T01056                                 

Gene name
kat2b
Definition
(RefSeq) histone acetyltransferase KAT2A
  KO
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:cin00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    100183071 (kat2b)
Enzymes [BR:cin01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100183071 (kat2b)
Transcription machinery [BR:cin03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     100183071 (kat2b)
Chromosome [BR:cin03036]
 Eukaryotic Type
  Histone modification proteins
   HATs (histone acetyltransferases)
    100183071 (kat2b)
   HAT complexes
    PCAF complex
     100183071 (kat2b)
    STAGA complex
     100183071 (kat2b)
    TFTC complex
     100183071 (kat2b)
    SAGA complex
     100183071 (kat2b)
    SLIK complex
     100183071 (kat2b)
    ADA-HAT complex
     100183071 (kat2b)
    HAT-A2 complex
     100183071 (kat2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
7
AA seq 670 aa AA seqDB search
YPRIKKLEKIGVYSSCKDDNCKCNGWKNAQSTSNSGENQTSSQQLTTTVTLQDPCRACNH
PLSTHVKHLDAAKDDEINRLLSMIVDVENLVVCVQKEEDTDTKQVYFYLYRLLRKCTLQT
SRPVIEGPLGSPPFSQPSIGKAVTNFIIYKFGHLPQKEFQIMHELAKTFIYCLNQETLET
PSTRTSRGQADDFNEYKMNYTRWLCYCRVPKFCESLVHHATVDTSPGTPGSFPSLFSMTS
PMGSLQTPIAVTPSGKRRADSGTQSSDDAKRARSSMQSDNDNTQQDFSLEVINEVVNMIT
DPAQMLGPEAANLSSQSARDEAARQEERQGLIEFHVVANCANASRQILTWLVEIQNVFAR
QLPRMPRDYIARLVFDTRHRTLALVKEGRVIGGICFRMFPSQRFTEIVFCAVTSNEQVKG
YGTHLMNHLKEYHIKQSMYHFLTYADEYAIGYFKKQGFSKEIKVPRSGYVGYIKDYEGAT
LMGCELNPRIPYTEFSNIIRKQKEIVKKLIEKKQQQISQVMPGLTCFKDGVRQIPIESIP
GIMNTGWKPNSDGKRKEIVESVESLFAPLKAIVQSMRSHSSAWPFLEPVKKSEVPNYYDV
IKSPMDLKTLNEQVRSKQYSTKAQFVTDAQKIFDNCRIFNSPESDYFKCANTMENFFYNK
LRDHGLVDGR
NT seq 2013 nt NT seq  +upstreamnt  +downstreamnt
tacccacgtattaagaagttggaaaaaatcggagtctattcatcttgcaaggatgataat
tgcaaatgtaatggttggaaaaatgcacaatcaacgtcaaattctggtgagaaccaaaca
agtagccaacaattaacgaccactgtaacactacaagacccatgtcgcgcatgtaatcat
ccactttctacacatgttaagcatttagatgcagctaaggatgatgaaatcaacagactg
cttagcatgattgttgatgttgaaaatcttgttgtttgtgttcaaaaagaagaagatacc
gatacaaaacaagtttatttttatttatatcggcttctacgaaaatgtactctgcaaact
agccgaccagtaattgaaggtccacttggttcacctccattcagccaacctagtattggg
aaagctgttaccaactttattatttacaagtttggccatttaccacaaaaggagtttcag
atcatgcatgagttagcaaagacatttatttactgtttgaatcaagagactcttgaaact
ccatcaacaagaacctcacgtggccaagctgatgattttaatgaatataagatgaattat
acgagatggctatgttactgtcgtgtaccaaagttttgtgaaagtctcgtccaccatgct
acagttgatacaagtcccggcacacctggtagttttccaagtttgttttccatgacatca
ccaatgggaagtcttcaaacaccaattgctgttacaccaagtgggaagcgtcgagctgac
agtggtactcagtcctccgatgatgccaagcgtgctcgctcatccatgcaatctgacaac
gataacacacaacaagatttttcactcgaagttattaacgaggtggtcaatatgataact
gatcctgctcaaatgttgggtcctgaggcggctaacctgtcatcacaatcagctagagat
gaagctgcacgacaggaagaaaggcaaggtctcatagagtttcatgtcgtagctaactgt
gccaatgcctcccgtcaaatcctcacatggctggttgagatacagaatgtattcgcacgt
cagctgccaaggatgccacgagattacattgctcgtttggtgtttgatacaaggcatagg
actttagctttagtgaaagagggtcgcgttattggtggaatttgttttcgaatgttccca
tcgcaaaggttcacagagattgtattctgtgctgtgacatccaatgaacaggttaaaggg
tatggaacgcatcttatgaaccatttaaaggaatatcacattaaacagagtatgtaccac
ttcctcacctatgctgatgaatacgctatcggttactttaagaagcagggtttcagcaaa
gagataaaagtcccacgatctggatatgtggggtacattaaagattacgaaggtgccact
ctaatgggatgtgaattaaacccaaggattccttacactgagtttagtaatataataaga
aagcaaaaagaaattgtaaagaaactgattgagaaaaagcagcaacagatcagccaagtt
atgcccggtctaacttgctttaaagatggggttcgtcagatacctatagaaagcatacct
ggcataatgaacactggatggaaaccaaatagcgacggcaaacgaaaagaaatcgtggaa
tctgttgaaagtttgtttgcacctctgaaagctatagtgcaaagcatgaggagtcacagc
agtgcatggccctttcttgaacccgttaaaaaatcggaggttcctaactactatgacgtc
ataaaatcgcctatggatttgaaaacgttgaacgaacaagtccgttctaagcaatattca
acgaaagcccagttcgttaccgacgctcaaaaaatcttcgacaattgccgcatatttaac
tcgcccgaatctgattactttaagtgcgcaaacaccatggaaaattttttctataacaaa
ttacgcgaccatggtcttgtagatggcagatga

DBGET integrated database retrieval system