KEGG   Ciona intestinalis (sea squirt): 100183071Help
Entry
100183071         CDS       T01056                                 

Gene name
kat2b
Definition
K(lysine) acetyltransferase 2B
Orthology
K06062  
histone acetyltransferase [EC:2.3.1.48]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Notch signaling pathway
Brite
KEGG Orthology (KO) [BR:cin00001]
 Environmental Information Processing
  Signal transduction
   04330 Notch signaling pathway
    100183071 (kat2b)
Enzymes [BR:cin01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     100183071 (kat2b)
Transcription machinery [BR:cin03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     100183071 (kat2b)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
7
AA seq 433 aa AA seqDB search
MTSPMGSLQTPIAVTPSGKRRADSGTQSSDDAKRARSSMQSDNDNTQQDFSLEVINEVVN
MITDPAQMLGPEAANLSSQSARDEAARQEERQGLIEFHVVANCANASRQILTWLVEIQNV
FARQLPRMPRDYIARLVFDTRHRTLALVKEGRVIGGICFRMFPSQRFTEIVFCAVTSNEQ
VKGYGTHLMNHLKEYHIKQSMYHFLTYADEYAIGYFKKQGFSKEIKVPRSGYVGYIKDYE
GATLMGCELNPRIPYTEFSNIIRKQKEIVKKLIEKKQQQISQVMPGLTCFKDGVRQIPIE
SIPGIMNTGWKPNSDGKRKEIVESVESLFAPLKAIVQSMRSHSSAWPFLEPVKKSEVPNY
YDVIKSPMDLKTLNEQVRSKQYSTKAQFVTDAQKIFDNCRIFNSPESDYFKCANTMENFF
YNKLRDHGLVDGR
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgacatcaccaatgggaagtcttcaaacaccaattgctgttacaccaagtgggaagcgt
cgagctgacagtggtactcagtcctccgatgatgccaagcgtgctcgctcatccatgcaa
tctgacaacgataacacacaacaagatttttcactcgaagttattaacgaggtggtcaat
atgataactgatcctgctcaaatgttgggtcctgaggcggctaacctgtcatcacaatca
gctagagatgaagctgcacgacaggaagaaaggcaaggtctcatagagtttcatgtcgta
gctaactgtgccaatgcctcccgtcaaatcctcacatggctggttgagatacagaatgta
ttcgcacgtcagctgccaaggatgccacgagattacattgctcgtttggtgtttgataca
aggcataggactttagctttagtgaaagagggtcgcgttattggtggaatttgttttcga
atgttcccatcgcaaaggttcacagagattgtattctgtgctgtgacatccaatgaacag
gttaaagggtatggaacgcatcttatgaaccatttaaaggaatatcacattaaacagagt
atgtaccacttcctcacctatgctgatgaatacgctatcggttactttaagaagcagggt
ttcagcaaagagataaaagtcccacgatctggatatgtggggtacattaaagattacgaa
ggtgccactctaatgggatgtgaattaaacccaaggattccttacactgagtttagtaat
ataataagaaagcaaaaagaaattgtaaagaaactgattgagaaaaagcagcaacagatc
agccaagttatgcccggtctaacttgctttaaagatggggttcgtcagatacctatagaa
agcatacctggcataatgaacactggatggaaaccaaatagcgacggcaaacgaaaagaa
atcgtggaatctgttgaaagtttgtttgcacctctgaaagctatagtgcaaagcatgagg
agtcacagcagtgcatggccctttcttgaacccgttaaaaaatcggaggttcctaactac
tatgacgtcataaaatcgcctatggatttgaaaacgttgaacgaacaagtccgttctaag
caatattcaacgaaagcccagttcgttaccgacgctcaaaaaatcttcgacaattgccgc
atatttaactcgcccgaatctgattactttaagtgcgcaaacaccatggaaaattttttc
tataacaaattacgcgaccatggtcttgtagatggcagatga

DBGET integrated database retrieval system