KEGG   Ciona intestinalis (sea squirt): 100183090Help
Entry
100183090         CDS       T01056                                 

Definition
triosephosphate isomerase B-like
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:cin00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    100183090
   01230 Biosynthesis of amino acids
    100183090
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    100183090
   00051 Fructose and mannose metabolism
    100183090
   00562 Inositol phosphate metabolism
    100183090
Enzymes [BR:cin01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     100183090
Exosome [BR:cin04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100183090
  Exosomal proteins of bladder cancer cells
   100183090
  Exosomal proteins of melanoma cells
   100183090
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
7
AA seq 247 aa AA seqDB search
MSGRRFFVGGNFKMNGNKSSLDDIITNLNTVNSPETDVVVAPSPLYLDYVTNKITSQVKV
AAQNCYKAAKGAYTGEVSPAMLSDVGVNWVILGHSERRHVFNESNELIGQKVKHALESGL
SVIPCIGEKLDEREAGVTEQVVFEQMTFIKDNVEDWSKVVIAYEPVWAIGTGKTATPGQA
QEVHEKLRKWLADNVSDDVSKSTRIIYGGSVNAGNCKELAKGKDIDGFLVGGASLKPEFL
DIIKANA
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgagtggacgacgttttttcgttggaggcaactttaaaatgaatggaaataaatcctct
ttggatgatattattaccaatcttaacactgtgaattcgcctgaaacagatgttgttgtt
gctccatctccactatatcttgattatgtcaccaacaaaatcaccagccaggttaaagtt
gctgcccagaactgttacaaagctgctaagggtgcttacactggtgaagtgagcccagca
atgctgtctgatgttggtgttaattgggtaatcctcggtcactcggaaagaagacatgta
ttcaatgaatcaaatgaattgattggacaaaaagtgaaacatgcattggaaagtggtttg
agtgtaattccatgtattggggaaaaacttgatgaaagagaagctggagttacagagcaa
gtggtgtttgaacaaatgacatttattaaagataatgtggaagactggagtaaagttgtc
attgcatatgagcctgtgtgggctataggaactggtaagacagcaactcctggccaagca
caagaagttcatgagaagctaaggaagtggttggctgataatgtatctgatgatgtttcc
aaatcaacaagaattatttatggcggttctgtcaatgctggaaactgcaaagagcttgct
aaaggaaaggatattgatggttttctagttggaggtgcatcactgaaaccagaattttta
gacatcatcaaagctaatgcataa

DBGET integrated database retrieval system