KEGG   Ciona intestinalis (sea squirt): 100183137Help
Entry
100183137         CDS       T01056                                 

Definition
3'(2'),5'-bisphosphate nucleotidase 1-like
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cin00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    100183137
Enzymes [BR:cin01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     100183137
Transfer RNA biogenesis [BR:cin03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    100183137
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 304 aa AA seqDB search
MSSSVILRVLAASVRIADKSASLVREIMSSGELGIVDKGGQKNLQTKADTSVEKLIRASL
LSLFPKLNVIGEEDEALDATADAKAGFDDDVLNKSSPPEYSKLTEDQIVVWVDPLDGTAE
FTEGLLDHVTILIGFAVNGEAIGGVINQPFYNYQAGSQAKLGRTIWGLVGLGAFGWNRSE
PPTGRRILITTRSHSNELVNLCLSSMSPTAVERQGGAGNKALRVIEGEADAYVFASPGCK
KWDTCAPEAILRAVGGQLTDVHGSKIRYDKDIKFPNTGGVIATYRDHQTIINLVPQKVRD
ELKS
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgagttcctcggttattttacgagttttagcggcctcggtccgaatcgccgacaaatct
gcgtccctcgtccgtgagattatgtcatcgggcgaactcggcatcgtggacaagggcgga
cagaaaaacctccaaacgaaagcggacacgtctgttgagaaactcatccgagcgtctcta
ctctcgttgtttcccaaactcaacgtcatcggggaggaagacgaagcgttggacgcgact
gctgacgcaaaagctggttttgatgatgacgtattaaataaatcgtcaccgcctgagtat
tccaaactcacagaagaccagatagttgtttgggtggatccactagatggcactgctgag
ttcactgaaggtttgttggatcatgtgaccatattaatcgggtttgccgtgaatggtgaa
gcgataggcggcgtaatcaaccaacctttctataactaccaagctggatcacaggcgaaa
ctaggtcgtacgatctgggggttagtggggttaggtgcgttcgggtggaaccgtagcgag
cccccaacgggacgaaggattcttatcaccacgaggtcacactccaacgaacttgtcaac
ttatgtttatcaagtatgtcgcccactgctgtagagaggcaaggaggggctgggaataag
gcattgcgagtaattgaaggggaggccgacgcttacgtgtttgcgtcaccggggtgtaag
aagtgggacacgtgcgcaccagaagcaatcctacgagccgtcggtggccaactaactgat
gtgcacggttcaaagatacgatatgacaaagacattaagttcccgaacaccggtggcgtc
atcgctacttaccgtgaccatcaaactatcatcaacctcgtgccacagaaagtacgcgat
gaactgaagtcataa

DBGET integrated database retrieval system