KEGG   Ciona intestinalis (sea squirt): 100183171Help
Entry
100183171         CDS       T01056                                 

Gene name
gpx_d
Definition
(RefSeq) glutathione peroxidase_like protein d
Organism
cin  Ciona intestinalis (sea squirt)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
Un
AA seq 197 aa AA seqDB search
MPKCKHSLFILLLSCILTYFLLPGKETSSMAGKDVKDIYGFTVNDIDDQEVSLSKYKGHV
CIIVNVASEUGFTKVNYEQLQQLYGKYSQQGLKILAFPCNQFGKQEPKPNADIKKFATEN
YGVTFDLFSKINVNGDNAIPLYKFLKTHKNTTGTLVNAIKWNFTKFLVTKQGIPYKRFAP
NAKPLDMVKDIEELLNQ
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgcctaagtgtaaacatagtctattcatattactgctcagttgcattctcacttatttc
ttgctccctggcaaagaaacttctagcatggctggaaaagatgttaaagacatttatggt
ttcacagtgaatgacattgatgaccaagaagtgtcattgtcgaaatataaaggacatgtt
tgtattattgtcaatgtggcctctgaatgagggttcacaaaagttaattatgagcagttg
caacagttgtatggaaagtactcacaacaaggacttaagatccttgctttcccgtgcaac
caatttggaaaacaagaaccaaaaccaaacgctgatatcaagaagtttgcgacggaaaat
tatggcgtaacctttgatttattctccaagattaacgtaaatggagacaacgcaattcct
ttgtacaagttcttgaagacccacaagaatacaacaggcacacttgtcaatgcaattaaa
tggaactttactaagtttctcgtaacaaaacaaggcattccatacaagagatttgctcca
aatgctaaaccactggatatggtaaaagatattgaagaattgttgaaccaataa

DBGET integrated database retrieval system