KEGG   Ciona intestinalis (sea squirt): 100183210Help
Entry
100183210         CDS       T01056                                 

Definition
28S ribosomal protein S18b, mitochondrial-like
Orthology
K16174  
small subunit ribosomal protein S18b, mitochondrial
Organism
cin  Ciona intestinalis (sea squirt)
Brite
Ribosome [BR:cin03011]
 Ribosomal Proteins
  Mitochondria
   Small subunit
    100183210
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
Un
AA seq 255 aa AA seqDB search
MSIRTSIYAINALKRTSQFNCARKIENSRCFHSKPLTLAMWGEKFNQFKPQVEAEDSNDR
ALRELDVTLLKPHPEWRNSAAGPIWPKDYHKLLWEKWEKNLHFKQDKVEQDKDWENYCEE
NGFSPQEYLETADFRTLYGERLIWENYVRNFKGGVQPQQTRSNCFRKGEMSTGSPCPLCR
DEKIMVTYNNLPLLHHFIDKQTGQLYSNLRTGACRFKHRRLVKAFSMAKDFGYLAAEAEF
VKYDLTDHRVNYSAL
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atgtcgattagaacaagtatatatgctattaatgctttaaaaaggacttcacaatttaac
tgtgccagaaaaattgaaaattcaagatgtttccattctaaaccattaacacttgcaatg
tggggagaaaaatttaatcagttcaaaccacaagttgaagcagaggatagcaatgatcgg
gcgttgcgggaattagatgttactttactaaagccccaccctgagtggagaaattctgct
gcgggaccaatttggccaaaagattatcataaactgttatgggagaaatgggagaaaaat
ttacattttaaacaagataaagtggaacaggataaagattgggaaaattattgtgaagaa
aatgggttttctccgcaagagtatctagaaactgcagatttccgaaccctgtatggggaa
aggctgatttgggaaaattatgttcgaaacttcaagggaggcgttcaaccacaacaaacc
aggagtaattgctttagaaaaggcgaaatgtcaactggttccccgtgcccactatgcaga
gatgaaaagataatggttacctacaataacctcccacttttgcaccacttcattgacaaa
caaaccggccaactttactccaacttacgaacaggggcgtgcaggtttaaacataggagg
ctggtcaaggcattcagcatggccaaagattttggttacctggcagctgaagctgaattt
gtgaaatacgacttaacagatcaccgcgtcaactattcagcattatga

DBGET integrated database retrieval system