KEGG   Ciona intestinalis (sea squirt): 100183249Help
Entry
100183249         CDS       T01056                                 

Definition
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase-like
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:cin00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    100183249
Enzymes [BR:cin01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     100183249
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     100183249
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
9
AA seq 181 aa AA seqDB search
MVRAWRILQEETDDPRDALYSNESVSLEQLAQVGVEYFKFDADTFEQNDDYLKLKNNRGY
SYSDTISVSRATLPDFDAKIKSFFEEHLHTDDEIRFILDGSGYFDVRDLDGRWIRIECVK
GDLLVLPSGIYHRFTLDKKDYIKALRLFIGVPVWTPHNRPADSMKERLDYVSKYLTATTT
N
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atggtaagagcgtggcgtattttgcaagaagaaacagacgaccctcgcgatgctttgtac
agtaatgagtctgtatccttagagcagctggcacaagttggcgttgagtattttaagttt
gatgcagacacatttgaacaaaatgatgattatctcaagttaaaaaataatagaggatac
tcgtatagtgatacaataagtgtgagcagagcaactctgccggatttcgatgccaagatc
aaatctttttttgaagaacatctccacacagacgatgaaatcagattcattttggacggt
tcgggttactttgatgttcgtgacttagacggccgttggatacgaatagaatgtgttaaa
ggcgaccttctggtgttaccgtctggtatttatcatcgatttactttggataaaaaggat
tatattaaagcactgcgattattcattggggttcctgtgtggactccacataacagacca
gctgattcaatgaaggaaaggcttgattatgtttccaagtacctcactgcaactactaca
aattga

DBGET integrated database retrieval system