KEGG   Ciona intestinalis (sea squirt): 100183288Help
Entry
100183288         CDS       T01056                                 

Definition
probable ubiquitin carboxyl-terminal hydrolase FAF-X-like
Orthology
K11840  
ubiquitin carboxyl-terminal hydrolase 9/24 [EC:3.1.2.15]
Organism
cin  Ciona intestinalis (sea squirt)
Brite
Enzymes [BR:cin01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100183288
Peptidases [BR:cin01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100183288
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 2576 aa AA seqDB search
MAVPDGISCRQDSYFSCAHLDTSEDKNSQIFRRQTNNSPVMDQAPPPYEEVVAITSTPAK
SADSNVPMAKVSPQNEVSKNENMGGGDASPESTINEAGVTDLGQKEAEPEFPMVELDQLE
EMINRTQWVVPVLPNGQLEVLLQCAIKQSTQAITVPCKRFLNSSLVVSFTKILTDDAVSN
WKLNIHECIYKNILLLIELCISKLSDDFPPLLELLGMAINPHCKYHIYNAQRASKSVPFD
AQLKDDELYARPADTRQPRGWLVDLVNYFGKLDGFEMLQKRFQSGTALNVPVIVALIRPF
GEVSELLTAHICQTYFLSVIEVVINRLDSLTDDEIKKEANKQEQQRGDSFSIILKSLKRI
LLRISLNEVEEKVRAIELFRLKMILRLLKISSFNGKMNALNEVNKVIHSVSYYPHSRHSL
DEEVWITAEKMAEWLKENKVLSIVLCDNLHQPQYVEKLEKILRFIIKEKSLTLDDLGSIW
NAQAGKHEAIVKNVHELLAKLAWDFSAEQLDHLFELFKESWAGASKKQREKLLELIRRLA
EDDKDGVMAHKVLNLLWNLAHSDDVPTEIMDQALSAHKKILDYSCSQDRDNQKLHWIDKF
TEELKSGNWVIPALRQIQGICLLFNEAPQNYPNMHRTQHFSYRPEIINRLQDKHSMVTLV
AVNLSNYVEFARTYAQENPRYRPSEIRNGSRYTHIQEINERLNFLRFILKDGQLWLCAPQ
ACQIWTCLAENSVYQSDQEACFQWFSKLMGEEPDLDPNINKEFFETKILQFDPGQLTQSG
MFCFERFFKTVNCHEKKLLPKHHSSGSFMMDALDLIGVPYMWRVVMNGKDDIATKAIQLL
QEIYTNLGPNLQVNQGSIHEDFIQSCLERLRVSFDNVNLLVGDNDATLDSSNDINNEIRR
MTRVLTVLSEYITKCDEECSFERTIIPMYRAARGENIILIIRFAAQGRQTEDFEILTHAN
ASLASVRKQVLSHFKLSSSGVMKAELYVNGEQLGTELDRKLIGSLSLKTRSTISLKLVQN
NSSGRASSSPESSSDSSSSSSPVPNQQSPLDSTTIEQQLPGTIMSLNPRYCSFLFKLADL
GCQIGSSSLRDEALHLLNLIPANIKTVNDIKQLTSDISKEKLAGSTHSSQKAIECLFFVS
SPSEALYNLNVLYFLLMPASNEACPDSSEVQLNFLRSNGTQLVLNMLTLSTFLANADVHT
KRSAYTTVLQVAKLMLTTVSYARVASVAEALNDSTNSNNPPVLHSVHNQAVILHSALEEI
PNPVNCMIMRSVASKLGQKCHAEIKDVTPDIQVIKQIMKLAWTSASDSLNLLGASNEDIH
QTFENSMRHNTNQENITLCQESLQVLTVALALCPHMLDSLQKDKTWQCFIIDLLLACPDK
MLRICACEQFQLIATKCSGGHKPLVFFITLLITVLKSTVCDYSQQCREYFSLLCRLLNFA
LCSSIHLQNAEVLLNNEIEWLKRVKEECKANGSLPVEEALLEGHLGVCKELISFQTPDKK
FHVGSDRGGAHLVKDMIEDFLFPASRAYIKYKNTGSKDENSFDFTSVRPVCNQPMTTIAA
FNVLCALCRGCIPNLRLLATALTELFYSDNEDTIKEWEFMPPVGPVAPSGFVGLKNAGAT
CYMNSVIQQLYLIPSIRDQMLGFDESFPDTYMITGDEEELVVDNLSSSNEKGDNECGKDE
ISNMEGTTSPEQSRATELKEYNKTLARQVQIIFGHLSYSKKQFYSPAGFWKHFKFMGEPV
NVREQHDAMEFFNSLVDGLDEGLKLFKQSPIFSKVLGGSFSDQKICKDCPHRYTREEPFL
SLSVDIRHHRNLKESLEQYVKGDLLEGANAYRCERCDKKVDTVKRLCIKKLPSVLCIQLK
RFDYDWERECAIKFNEYFEFPREIDMEPYTVAGLAKIEGEVIEAMGNDSDADVPTNYRLV
GVIVHSGQASGGHYYSYILQRSKGGEARNKWFKFDDVDVSECEFTDEDMKNQSFGGDYMG
EVFDHMVKRMQYRRQKRWWNAYLLFYERVDVLKDYELSKSIHNLSLGSSFEGSNLPKVIE
RRVQLKNIEFMHKRMQFSREYFSFMQQLLRINFQYFMGGDKQQVQLSAEAEELCMISVQL
AAKFIFSTGFHTKKAVRGPAIEWYDILFHLMRNCKSARKWFVQNELLNHPHRFSQYLLQC
TSSDVRTAFAKLLVFLAHFTITDGPIHLPTEGSPEQNPPKMMSDLILQRVFNLLKKDVSE
HGRHLPQYFSVFAMYLNLGVVNRKQLLQLQVPHYFILTALDDGPGPPIKYQYAELNKLYQ
VVSLLVRCCDVSQHCTSSKPGQAALPNPYGDRSITHPIIPLQSNVVDLLMTNKSYVKKII
EDGSNTDETLKLLKFLCWENPQMSRVVLSELLWQIAYSYTYELRPHLDLLLQMLMLEDSW
QHQRIINTLKGIPDDRDGLFTTIQRSKAHYAKRAYQCIKCMTTLFSNCPVAYQLLFNNGE
LKRRWSMSVEWLGDELDRRSYGTGNTGGQYNYNNWSPPAPSNESANGYFLEHSQSAKHTL
AKASELCPVEEPEDIEVSEEQESDNPPISDPTVVTQYAPEIDQQSNKTSENKLDET
NT seq 7731 nt NT seq  +upstreamnt  +downstreamnt
atggcagttcctgatgggatctcatgtaggcaggacagttatttctcgtgtgcgcacttg
gatacaagtgaagataagaattctcagatatttagacgtcagacaaataattcccctgtc
atggaccaagcaccaccaccctatgaggaagtagtggcaataaccagtacaccagccaag
tctgcagacagtaatgttccaatggctaaagtctccccacaaaatgaagtttccaaaaat
gagaatatgggaggtggagatgctagtcctgaaagcacaataaatgaagctggggtgaca
gaccttggtcagaaagaggcagaacctgaatttccgatggttgagttggatcaactcgaa
gaaatgatcaatagaacgcagtgggtggttccagtgttgcccaacggacaacttgaagtt
ttactgcaatgcgcaataaaacaaagcacacaagcaatcactgttccatgcaaaagattc
ctcaacagcagtttagttgtttcctttaccaagatcctcacagatgatgcagtgagcaac
tggaagttaaatattcatgagtgcatttacaagaacatcttgctgctcattgaactttgc
atttcaaaattatcggatgattttcctcctttgcttgaactgcttggtatggccatcaac
ccacactgcaagtatcatatatacaacgcacagagggcttcaaagagtgttccctttgat
gcccaacttaaggatgatgaactatatgcacgacctgcagacacaagacaaccaaggggt
tggttggtggatttagtgaattactttggaaagttggatggtttcgaaatgttacaaaaa
cgatttcaatctggaacagcactcaatgtcccggttatagttgcattgataagaccattc
ggtgaagtatccgaacttctgactgctcacatatgccaaacgtacttcctatctgttatt
gaagtcgtgattaaccgtcttgactctcttactgatgatgagatcaagaaggaagcaaat
aagcaggagcaacaaagaggagattccttctccatcatcctcaaatcactcaagcgaatc
ctactcaggatctcactgaatgaggtggaagagaaagtaagagcaattgagctctttcgc
ctcaagatgattctcaggctgttaaagatctcatcattcaatgggaaaatgaacgcatta
aatgaagtaaataaggttatacacagcgtgtcgtattatccacacagcagacattcactg
gatgaagaagtttggataacggcagaaaaaatggcggaatggttgaaagaaaacaaagtc
ttatcaatcgtgttgtgtgataatctacatcaaccacaatatgtggaaaaacttgaaaaa
attcttcgttttataattaaagagaaatccctcacattagatgatctgggaagcatctgg
aatgctcaggcaggaaaacatgaagccattgtgaaaaatgttcacgaacttttagcaaaa
cttgcatgggatttctctgcagagcagttggatcatctgtttgaacttttcaaagaaagt
tgggcaggagcgagtaaaaagcagcgagagaagttgttggagttgatccggaggttggct
gaagatgataaggatggagtgatggctcataaagtcctcaacctcctatggaacctcgca
cactctgatgatgttccaacagaaatcatggaccaagcactaagtgctcataaaaagatc
ttagactacagttgctcccaagatcgcgacaaccaaaaacttcactggatcgataaattc
actgaagaattgaaaagtggtaactgggtgattcctgcacttcgacaaatacaaggaata
tgtttgttatttaatgaggctccacaaaactacccaaacatgcatcggacgcaacatttc
tcgtaccgacctgaaataattaatcgattgcaagacaaacactccatggttacgttggtt
gccgtcaacctttccaactatgttgagttcgcaagaacctacgcccaagaaaatcctcgt
tacaggccaagtgaaataagaaatggaagtagatacacgcatatacaggagataaatgaa
agactgaactttctacgttttatattaaaagatggtcagttatggttatgtgcgccacaa
gcttgtcagatatggacatgtcttgctgagaacagtgtttaccagagtgatcaggaagct
tgctttcaatggttctcaaaactaatgggtgaagaaccagacctggacccaaatataaat
aaggagtttttcgaaaccaaaatactccagtttgatcccggtcaacttacacaaagtgga
atgttttgtttcgaacgattctttaaaactgtcaactgtcatgagaagaaacttcttcct
aaacaccattcatctggaagttttatgatggatgcgcttgatcttattggagtaccttat
atgtggagggttgtgatgaacggcaaagatgacattgcaacaaaagcaattcaacttctg
caggagatttacacaaaccttggtcccaaccttcaggtcaaccagggaagcattcatgag
gatttcatccaatcatgtcttgaacgacttcgtgtctcattcgacaatgttaacctcttg
gttggtgacaatgacgcaacattagattcaagcaacgatataaataacgagatccgtcga
atgactcgtgtcctcactgtgttgagtgaatatatcactaagtgtgacgaggaatgctca
tttgagagaactattattcctatgtacagggcagcacgtggagaaaacatcatcttgatc
atcagattcgccgcacaaggacgacaaacggaagactttgagattctcactcatgccaat
gcttcacttgcttctgtcagaaagcaagttctcagccacttcaagttaagcagttcaggt
gtgatgaaagctgagttgtacgttaatggtgaacagcttggaaccgaacttgatcggaaa
cttatcggaagtttgtcattaaaaactcgcagtacaatctctctgaagttagttcaaaac
aacagctctggccgtgcgtcctcatcaccagaatcaagctccgatagttcatcttcctca
tctcccgttcccaaccaacaatctcctcttgactcaaccaccatcgagcaacaactcccg
ggaaccatcatgtccctcaacccaaggtattgttctttcctcttcaaacttgctgacctt
ggatgtcaaattggatcctcgtctcttagagatgaagcgcttcatcttcttaatctcata
ccagccaacattaagactgtcaatgacattaaacagctaacatcggatatatcgaaagaa
aagttagctggttcgactcattcaagtcagaaagcgatcgaatgtttgttctttgtttca
tctccttcagaagctctctataatttaaatgttttatatttcctcctgatgcctgcatcg
aatgaggcgtgtcctgactcaagtgaggttcaacttaacttccttcgaagcaacggaaca
caacttgtgctcaacatgctcacactaagtacattccttgctaatgctgacgtgcatact
aaacggagtgcgtacacaactgtgttacaagttgctaaactaatgctcacaacagtgtct
tatgctcgtgtggcatcagttgctgaagctttgaacgacagtacaaacagcaacaacccc
ccagtgttacacagtgtgcataaccaagcagttattcttcattctgcactggaagaaata
ccgaacccagtcaactgtatgatcatgagatctgtggcttcaaaacttggtcagaaatgt
catgctgagataaaagacgtgacacctgacatacaagttattaagcagataatgaagttg
gcttggacttctgcaagcgattcacttaatttactcggggctagcaacgaagatattcat
caaacatttgaaaattcgatgcgtcacaacaccaaccaggaaaacatcactttgtgtcaa
gaatcattacaagttctcactgtagctctcgccttgtgtccacatatgcttgattcacta
cagaaggacaaaacatggcagtgttttattattgacttgcttctggcttgtcctgataag
atgttgcgcatatgtgcttgcgaacagttccaacttatcgccaccaaatgttcaggtggt
cacaaacctctcgtgtttttcatcacgttactcatcacagttcttaagagcactgtatgt
gattattctcaacaatgtcgcgaatatttctcgttattatgtcgactgcttaactttgct
ctctgttcgagcatccatcttcaaaatgctgaagttcttcttaataatgagattgaatgg
cttaaacgggtcaaggaggaatgcaaagcaaatggaagtcttccagtagaagaagcttta
ttagaaggtcaccttggtgtgtgtaaggaacttatttcatttcaaacaccagataaaaag
ttccatgttggttcagatcgtggtggtgcacaccttgtcaaagacatgattgaggatttt
ctcttccccgcatctcgagcgtacattaaatacaagaacacgggaagcaaggatgaaaat
agtttcgactttacatccgtacgtcctgtgtgcaatcaaccgatgacaacaattgctgcg
tttaacgtgttgtgtgcgttgtgtcgtggttgtattccaaaccttcggttacttgctact
gctcttactgaacttttctattctgataatgaggatacaataaaagaatgggagttcatg
ccccctgtaggtccagtggccccaagcgggttcgttgggctcaagaacgccggtgcaacg
tgctacatgaactcagtgatccaacagctctacctgatcccgagcatccgagatcagatg
ttgggtttcgatgaatcgttcccggacacatacatgatcacgggagatgaggaagaatta
gtcgttgataatttgtcgagttcgaatgaaaaaggagataatgagtgtggtaaagatgag
atcagcaacatggaaggcacaacttctcctgagcaaagcagagctacagagttaaaggaa
tataataaaacattggcacgccaagtacaaatcatattcggtcatctctcgtacagtaag
aagcagttttattcacctgctgggttttggaagcattttaaattcatgggtgaaccagtg
aatgtacgtgaacaacacgacgcgatggaattcttcaattcattggttgatggtttggat
gaagggctcaagttgttcaaacaatccccgatatttagcaaagtacttggtggaagcttc
tccgatcaaaagatttgtaaagattgtccccacagatacacacgtgaggaacctttccta
tcattaagtgttgatattcgtcatcatcgtaacttgaaggaatcactcgaacaatatgtg
aagggggatttacttgaaggtgcaaacgcttatcgatgtgaaagatgtgataaaaaggtt
gacacggtgaagcgactttgtataaagaagcttccatcagtgctttgtattcaattgaag
aggtttgattacgactgggagagagaatgtgccatcaagttcaacgagtattttgaattt
cctcgtgaaatagatatggagccttatacagtggctggcttggcaaagatagaaggagag
gtaattgaagcaatgggaaacgattccgatgccgacgtaccaaccaactatagattagtt
ggtgtgattgttcatagtggacaagccagtggtggacattactattcctatatcttacaa
agatctaagggtggagaggcgaggaacaaatggtttaagtttgatgatgttgatgttagt
gagtgtgagttcactgatgaagacatgaagaaccagtcgtttggtggagattatatggga
gaggtgtttgaccatatggttaaaagaatgcagtatcgaagacagaagcgctggtggaac
gcttaccttctcttctatgaacgtgttgatgtgctgaaagattatgagctgagcaaaagt
attcataatttatcacttggttcttcatttgaaggaagtaaccttcccaaagtaattgaa
cgcagagttcagttgaagaacatcgagtttatgcataagaggatgcaattcagtagagaa
tatttcagtttcatgcagcagttacttcgcatcaacttccagtatttcatgggtggagat
aaacaacaagttcagttatctgctgaagctgaagagctgtgtatgatcagtgtacaactt
gctgccaagtttatattcagtactggtttccacacgaagaaagcagtgcgcgggcctgcc
atcgagtggtatgatattctcttccatttaatgaggaattgcaagtcagcgaggaaatgg
ttcgttcaaaatgaactcctcaaccatccacacaggttcagtcaatacttattacaatgc
acttcatctgatgttcgaacagcgtttgcaaagttgttagtattccttgctcattttact
attactgatggaccaatacatttacctacagaggggagtccagagcaaaaccccccgaaa
atgatgagtgacctcatcttacaaagagtcttcaatttactgaagaaagatgtttcggaa
catggtcgtcacttgccccagtatttctctgtgtttgcaatgtatcttaatcttggtgtg
gtgaacaggaaacagcttctccaacttcaagttccgcactacttcatcctgacagcatta
gatgatggaccaggtccccccattaaatatcaatatgctgaactcaataaattataccag
gtggtatcactgcttgttagatgttgtgatgtctctcaacactgcaccagctcaaagcca
ggtcaagcagcattacccaacccatacggtgatcgttcaatcacccaccccattatacca
cttcaatctaacgtggttgatctgctcatgactaacaagagttatgtgaagaagataatt
gaagacggaagtaacactgatgaaacactcaagctactcaaatttctatgctgggagaat
ccacagatgtcgagagttgtgttgagtgaattattatggcagatcgcgtactcgtacaca
tacgagcttcgtcctcatcttgatcttcttcttcaaatgttgatgttggaagattcatgg
caacatcagaggatcatcaacacattgaaagggatacctgatgatagagatggtttgttc
accacgatccaacgctcaaaagctcattacgccaagcgagcatatcagtgcattaaatgc
atgacaacattgttcagcaactgcccagtggcgtatcaacttctatttaacaatggtgaa
ctgaaaagaagatggtccatgagtgtggaatggttgggtgatgagttagatcgtcgctcg
tatggaactggcaacactggaggtcagtacaactacaacaactggtcaccaccagcacct
tccaatgaatcagcaaacggatattttctggaacattctcagagtgccaaacacactctg
gctaaagcatcagagctttgccctgttgaggagccagaagatatagaagtaagtgaggaa
caagaaagtgacaatcctcctatcagcgatcccactgtggttacccaatatgcaccagaa
attgatcagcaaagtaacaaaacaagcgaaaataaactggatgagacctga

DBGET integrated database retrieval system