KEGG   Ciona intestinalis (sea squirt): 100183445Help
Entry
100183445         CDS       T01056                                 

Definition
3-hydroxybutyrate dehydrogenase type 2-like
Orthology
K00019  
3-hydroxybutyrate dehydrogenase [EC:1.1.1.30]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Synthesis and degradation of ketone bodies
Butanoate metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:cin00650]
Metabolism; Lipid metabolism; Synthesis and degradation of ketone bodies [PATH:cin00072]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
Un
AA seq 248 aa AA seqDB search
MGRLAGKVIVVTAAAQGIGRASVEAFAAQGAIVYASDINLEKLKEIEKPGSIFVAKLDVT
KNDDILAYAATIPKVDVLFNVAGMVHHGTILDCDEASWDLSMSVNVKSMFFMTKAFLPKM
IDAKCGNIINMSSVASSKIGVPLRCVYQTTKAAIVGLTKSVATDFASQGIRCNCIQPGTI
DTPSLNDRINNNPKQDPVKARSMFESRMPAGRFGRADEVAQLAVYLASDESSYVTGGEHV
IDGGWSLV
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atgggtcgattggcaggcaaagttattgtggtgactgcagcggcacagggcattggaaga
gcttccgtggaagcgtttgccgcccagggtgctatcgtttacgcaagtgatataaacctc
gagaaattgaaagaaatcgaaaaacctgggagtattttcgttgcgaaattggacgtcacg
aaaaatgatgatattttggcttatgctgctactatacccaaagtggatgttttattcaat
gtggctggaatggttcaccatggcacaatacttgactgtgatgaggcgtcatgggattta
tcgatgtccgttaacgttaagagcatgttctttatgaccaaggcattcttaccaaagatg
attgacgcgaagtgcgggaatattattaatatgtcgtccgtggcttctagcaagataggt
gtccccttacgatgtgtataccaaaccaccaaagctgccatagtgggtcttactaagtca
gtagctaccgactttgcaagccaaggtatccgatgtaactgcatacaacctggtaccatc
gacacaccctcgcttaatgatagaatcaacaataatccaaagcaagacccagttaaggct
cgttctatgtttgaatctcgaatgccagctggaaggttcggacgcgctgatgaagtcgct
caactcgccgtgtaccttgcaagtgatgagtcatcatacgtcactggaggcgaacacgtc
atagacggcgggtggtcgttggtttaa

DBGET integrated database retrieval system