KEGG   Ciona intestinalis (sea squirt): 100183454Help
Entry
100183454         CDS       T01056                                 

Definition
lysosomal thioesterase PPT2-A-like
Orthology
K01074  
palmitoyl-protein thioesterase [EC:3.1.2.22]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Fatty acid elongation
Metabolic pathways
Fatty acid metabolism
Lysosome
Brite
KEGG Orthology (KO) [BR:cin00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    100183454
  Lipid metabolism
   00062 Fatty acid elongation
    100183454
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100183454
Enzymes [BR:cin01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.22  palmitoyl[protein] hydrolase
     100183454
Lipid biosynthesis proteins [BR:cin01004]
 Fatty acid synthase
  Component type
   100183454
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 292 aa AA seqDB search
MTTWRSLLSTIVLLFQAIKTFGYKPVIVVHGILDDAKDLSHLTKFITKHHPGTEVHTLDL
FDHYHSFIPLWDQLDTIKNFTAPIMQKAKDGVHLIGYSQGGIVGRGLVQTSNDHNIHNFI
ALSSPLNGQFGDTSFINWLFPSALKEELYKIFYTHYGQLWSIGNYWKDPHHPLMYRQYSD
YLAALNNESLREDFKFPSSWKGNLLRLKNMMLIGGPDDGVIAPWQSAHFGCYNKEEKVIP
MRKLQMYQKDEIGLKTLDETGRLQECTIPGVHHTLWHKNETVFLDCIAPLLT
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atgacgacctggagaagcttattgtcaaccatagttttgctgtttcaagctattaagact
tttggatacaagccagttatcgttgtacacggtatcctagacgatgctaaagatttaagt
catttgaccaaatttattactaagcatcaccctggtaccgaagtacacacattagatctc
tttgaccattaccacagcttcattccactttgggatcaactcgatacaatcaaaaacttt
actgctccgattatgcaaaaagccaaggacggtgttcatttgatcggttattcccaaggt
ggaatcgttggcagaggtttagtgcagacaagtaatgatcataacattcacaatttcatt
gctttgtcatcaccactcaatggacaatttggagatacatcctttattaattggctgttt
ccatctgcattgaaagaggagttgtacaaaatattttacacacattatggacaactgtgg
tctattgggaattattggaaagacccacaccacccacttatgtacaggcagtacagtgac
tacttggcggcgttgaacaatgaaagtttaagggaagattttaagtttccttcttcctgg
aaggggaacttgctaagattaaagaacatgatgttgatcggaggtccggatgatggagtt
attgctccctggcagtccgctcattttgggtgttacaacaaagaagaaaaagtgattcct
atgagaaaattgcagatgtaccaaaaagatgagattggtttaaaaactcttgatgaaaca
ggaagattacaggaatgtactataccaggtgttcatcatacattgtggcataagaacgaa
actgttttcttggattgtattgcaccccttcttacatag

DBGET integrated database retrieval system