KEGG   Ciona intestinalis (sea squirt): 100183558Help
Entry
100183558         CDS       T01056                                 

Gene name
gpx_c
Definition
glutathione peroxidase_like protein c
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:cin00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:cin00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 215 aa AA seqDB search
MHQKGAVPAVLLVLGTLAVATSIENSTCFHNTFSVYDHSFPTLSGETVNLGEFRGNVSMV
INVATYUGATVPQYKAMNALSEEYTQSSFVTLAFPCNQFGLQQPEANDEILNGVMYVRPG
HGFVPNKKIYFFSKTQVNGGSEDPLFTSIKASCPPTTNNIGITSELYWTPIKANDIYWNW
NKFLLDKNGMIRYRFGSAVTATQLKPWIDQLLNEK
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgcatcaaaaaggcgcggttcccgccgtgcttctggtgctaggcactttggctgttgca
acttctatagaaaattcaacatgttttcataacacgttttctgtgtacgaccattcgttt
ccgaccttgtcaggtgaaacggtaaacctcggggaatttcgtggtaacgtctccatggtg
atcaatgtcgccacttactgaggggcgactgttccacaatataaagccatgaatgcactg
tctgaggaatacacccaatcaagttttgtgacactggccttcccatgcaatcagttcgga
ctccaacaaccagaagcaaacgacgaaatattaaacggcgttatgtatgttcgacctgga
cacgggttcgttccaaacaagaagatttatttctttagtaaaacgcaagtaaacggaggt
agcgaagatccgctgtttacatcgattaaggcttcttgtcccccgaccactaacaacatt
ggaataacatctgaattatattggacaccaattaaagcaaacgatatatattggaactgg
aataaatttctgctggataaaaatgggatgatcagatataggttcggaagtgctgttact
gccacgcaattaaagccttggatagatcagctacttaacgaaaagtaa

DBGET integrated database retrieval system