KEGG   Ciona intestinalis (sea squirt): 100183611Help
Entry
100183611         CDS       T01056                                 

Definition
phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform-like
Orthology
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Inositol phosphate metabolism
FoxO signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
Jak-STAT signaling pathway
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:cin00562]
Environmental Information Processing; Signal transduction; Jak-STAT signaling pathway [PATH:cin04630]
Environmental Information Processing; Signal transduction; FoxO signaling pathway [PATH:cin04068]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:cin04070]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:cin04150]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 1082 aa AA seqDB search
MSISRAFSGVHLGGSGGAYDEEESIYDEWGYHNSMYVSVDFFLPTGIYIPIDIPRNSTIK
EVKNLLWQEAIHHPLFSKLLNPESYTFTYITSFGLPEEIVDESRHLSEFDIFHELPVLKL
VQSRGNIAEKRVIQEINHLTCIKNETELNVDSESRSFRKDMRELAAQACKDRDTLHWKSL
LQRHFPPTIIPYLNESTHYLKDFGLIQLTSENSETVYTIKINPSWSTEHLTEVALQTWVS
KTKARLPSTNKDDYVLKGNGKEFIVGNHPIYMFKFLRKALVCKREGIVSSIKAPPVVSLV
HVASVRKILPQQYQLLKKVQTNFAPPVPEKHRAVWSLWQLDVMFKLRIIRAGNVNAGQER
DKKLVVHVGLYHGTETLCPTTYTKEPVKEMAAGNEYQWDEECFFDINAVNLPRNAMLCLA
ICSSKRNVGGKSKRKESTQKNTQHSASPIAWANMMVFDFKRYLKAGLYRLNCWQVNHDNL
DSNNLSPRGGVMLNPDVEQAAFIEIMMPEYQATIMYPSLPEVLEEAARQAVVRESNLMTR
GASKSHMTQLDEVVRKDRFDDLFDDDKSLLWRLRIDCREKYPEALSKVLASAKWNSYKSV
AMVQAMLNSWTPLSPERAMELLDCQFADEHVRDFAVKCLENLRDDELQQYLMQLVQVVKF
DSYLNSSLVRFILRRAWSNRKIGHFLFWHLKAEISNTLLNLRFALIMEAYLYGNLPHVKT
LYKQQEALNKMRTLNERVKGSEFSQKDIKVRARQALKDTANQDSFKEALTSVECPLEPNL
DLEELLVEKCKVMNSKMRPLWLVFKNKQVQDGSMSVIYKNGDDLRQDMLTLQTISIMDML
WKAEGLDLRMIPYGCLATGKGTGMIEVVTHSNTIANIQKTRGGKMSAFRHQTLIEWLEQN
NSTPSEFEQAIENFTYSCAGYCVATFVLGVGDRHSDNIMVTEKGQLFHIDFGHILGNFKT
KFGIKRERVPFVLAHDFVHVINKGKTNNKADFDQFRKLCDNAFCILRKKGYLIITLFALM
LHSGLPEMTSLDHLEYLRETLALHLTEQKALQQFRSKFNKALTDAWATSVNWFFHNVARD
NT
NT seq 3249 nt NT seq  +upstreamnt  +downstreamnt
atgagtatttctcgtgcattttcaggcgtccacctggggggaagtggaggtgcttatgac
gaagaggaatctatatatgatgaatggggttaccacaactctatgtatgttagtgtagat
ttctttctaccaacaggaatctacataccaattgatataccaaggaattcaaccataaaa
gaagtgaaaaatttactatggcaagaagcaatccaccatcctttattcagcaagcttctt
aaccctgaaagttacactttcacatacataacaagttttggtttaccagaggaaattgtt
gatgagagtcggcatctcagtgagtttgatattttccatgaactgccggtgttgaaactc
gttcaaagtagaggtaatattgcagagaaacgggttatacaagaaataaaccaccttaca
tgcatcaaaaatgaaactgaattgaatgtggacagtgagagtcgatcgtttagaaaagac
atgcgggagttagctgctcaagcttgtaaggatcgagatactctacactggaaatcactt
cttcaacgccattttcctccaaccatcatcccatacctcaacgaaagtactcactactta
aaagattttggcctcattcagttaacatcagaaaattccgagacggtatacaccattaaa
atcaacccttcgtggtcaacggaacacttaacggaagtcgcactccagacttgggtttcg
aaaacaaaagctcgccttccttccaccaataaggacgattatgttttgaaaggaaatgga
aaagagtttattgttgggaatcacccaatttatatgtttaagttcttacgaaaagcactg
gtatgtaaacgtgaaggtattgtcagtagcatcaaagcacctccagttgtttctctggtt
catgttgcaagcgtgagaaaaattttaccccagcaataccaacttttaaaaaaagtacag
acgaactttgcccctcctgtgccagaaaaacatcgagcagtttggtcactatggcaactc
gatgttatgttcaaattaagaatcataagagctggtaacgtcaatgcaggccaagagagg
gacaaaaagctagtggtccacgttggtttataccatggaacagaaacgctgtgtcctacc
acctacactaaagaaccagtaaaagagatggcagcgggtaatgagtaccagtgggatgaa
gaatgtttctttgatataaatgcagttaaccttcctcgaaatgcgatgctttgtctcgct
atctgctccagcaaacgaaatgttggtgggaaatctaaaagaaaggagtcaactcaaaaa
aatactcagcattctgcatctcctattgcttgggctaatatgatggtgtttgatttcaaa
agatacctcaaagctggcttgtaccggttaaactgctggcaagtgaaccacgataatctt
gactcgaataacttgagtcctcgtggaggagtaatgcttaatccggatgttgaacaagct
gctttcatcgagataatgatgccagagtaccaagctaccatcatgtatccgtctctaccg
gaagtgttagaagaagcagctcgtcaagcagttgttcgtgaaagcaacttaatgacgcga
ggcgcttccaaatctcacatgacacaactggatgaagttgttagaaaagatcgtttcgac
gatttatttgatgacgataaaagtttgttgtggcgattacgaatcgactgtagggaaaaa
tatcctgaagctctttcaaaagttctcgcatctgcaaagtggaattcatacaagagtgtt
gccatggtgcaagcaatgctcaattcatggacacctttgtcaccggagcgcgccatggag
ctgttggattgtcagttcgccgatgaacatgtgagggacttcgctgtgaagtgtttggaa
aacttaagagatgacgaactgcaacaataccttatgcagttggttcaagttgttaagttc
gattcttacctgaacagtagtttagttcgtttcattcttcgtcgtgcttggagcaaccga
aaaatcggacattttttgttttggcatttaaaagcggaaatttcgaacacgttgttaaat
cttcgtttcgcgttgatcatggaagcttacttgtatggtaacttaccgcatgtgaagact
ttgtataaacaacaagaagcgctcaataaaatgagaactttgaatgaaagggttaaagga
tctgagtttagtcaaaaagatattaaagttcgggctcgacaggcattgaaggatacggcg
aaccaggattcatttaaagaagctcttactagtgttgaatgtcctctggaacctaacttg
gacttggaggaattacttgttgaaaaatgcaaagtcatgaacagtaaaatgagacctcta
tggttggttttcaaaaacaagcaagtacaagacggaagcatgagcgttatctacaaaaac
ggagatgatcttcgccaagatatgctgactttacaaaccatatctatcatggatatgctg
tggaaagctgaaggtttggacttgagaatgatcccgtatggttgccttgcaactgggaaa
ggcacgggcatgatagaagtagtcacgcattcaaatacaatagccaacatacagaagaca
agaggtggaaaaatgtcggcgttcagacaccaaacgttaattgaatggcttgaacagaac
aactcaaccccgtcagaatttgagcaagcaatagaaaacttcacgtactcctgtgctggt
tattgtgtggccacgtttgtgcttggtgtgggtgatcggcactctgataatattatggtc
actgagaaaggacagcttttccacattgactttgggcatattcttggaaactttaagact
aaatttggaatcaaaagagagagagttccgtttgttcttgcgcacgacttcgttcatgtt
atcaacaaagggaaaaccaacaacaaggctgatttcgatcaattccgaaaactttgtgat
aatgcattctgtattctgagaaagaagggttatctgatcattacattgtttgcgttgatg
cttcattctgggttgcctgagatgacatcgttggaccatttagaatacttgcgtgagacc
ttagccctccacttaacagaacagaaagctctgcaacaattccgcagcaagtttaataaa
gccctcactgatgcatgggctacctcagttaattggttctttcataatgtagcacgggat
aacacgtga

DBGET integrated database retrieval system