KEGG   Ciona intestinalis (sea squirt): 100183611Help
Entry
100183611         CDS       T01056                                 

Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform-like
  KO
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Inositol phosphate metabolism
FoxO signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
Jak-STAT signaling pathway
Insulin resistance
AGE-RAGE signaling pathway in diabetic complications
Module
PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:cin00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100183611
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    100183611
   04068 FoxO signaling pathway
    100183611
   04070 Phosphatidylinositol signaling system
    100183611
   04150 mTOR signaling pathway
    100183611
 Human Diseases
  Endocrine and metabolic diseases
   04931 Insulin resistance
    100183611
   04933 AGE-RAGE signaling pathway in diabetic complications
    100183611
Enzymes [BR:cin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100183611
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 1082 aa AA seqDB search
MSISRAFSGVHLGGSGGAYDEEESIYDEWGYHNSMYVSVDFFLPTGIYIPIDIPRNSTIK
EVKNLLWQEAIHHPLFSKLLNPESYTFTYITSFGLPEEIVDESRHLSEFDIFHELPVLKL
VQSRGNIAEKRVIQEINHLTCIKNETELNVDSESRSFRKDMRELAAQACKDRDTLHWKSL
LQRHFPPTIIPYLNESTHYLKDFGLIQLTSENSETVYTIKINPSWSTEHLTEVALQTWVS
KTKARLPSTNKDDYVLKGNGKEFIVGNHPIYMFKFLRKALVCKREGIVSSIKAPPVVSLV
HVASVRKILPQQYQLLKKVQTNFAPPVPEKHRAVWSLWQLDVMFKLRIIRAGNVNAGQER
DKKLVVHVGLYHGTETLCPTTYTKEPVKEMAAGNEYQWDEECFFDINAVNLPRNAMLCLA
ICSSKRNVGGKSKRKESTQKNTQHSASPIAWANMMVFDFKRYLKAGLYRLNCWQVNHDNL
DSNNLSPRGGVMLNPDVEQAAFIEIMMPEYQATIMYPSLPEVLEEAARQAVVRESNLMTR
GASKSHMTQLDEVVRKDRFDDLFDDDKSLLWRLRIDCREKYPEALSKVLASAKWNSYKSV
AMVQAMLNSWTPLSPERAMELLDCQFADEHVRDFAVKCLENLRDDELQQYLMQLVQVVKF
DSYLNSSLVRFILRRAWSNRKIGHFLFWHLKAEISNTLLNLRFALIMEAYLYGNLPHVKT
LYKQQEALNKMRTLNERVKGSEFSQKDIKVRARQALKDTANQDSFKEALTSVECPLEPNL
DLEELLVEKCKVMNSKMRPLWLVFKNKQVQDGSMSVIYKNGDDLRQDMLTLQTISIMDML
WKAEGLDLRMIPYGCLATGKGTGMIEVVTHSNTIANIQKTRGGKMSAFRHQTLIEWLEQN
NSTPSEFEQAIENFTYSCAGYCVATFVLGVGDRHSDNIMVTEKGQLFHIDFGHILGNFKT
KFGIKRERVPFVLAHDFVHVINKGKTNNKADFDQFRKLCDNAFCILRKKGYLIITLFALM
LHSGLPEMTSLDHLEYLRETLALHLTEQKALQQFRSKFNKALTDAWATSVNWFFHNVARD
NT
NT seq 3249 nt NT seq  +upstreamnt  +downstreamnt
atgagtatttctcgtgcattttcaggcgtccacctggggggaagtggaggtgcttatgac
gaagaggaatctatatatgatgaatggggttaccacaactctatgtatgttagtgtagat
ttctttctaccaacaggaatctacataccaattgatataccaaggaattcaaccataaaa
gaagtgaaaaatttactatggcaagaagcaatccaccatcctttattcagcaagcttctt
aaccctgaaagttacactttcacatacataacaagttttggtttaccagaggaaattgtt
gatgagagtcggcatctcagtgagtttgatattttccatgaactgccggtgttgaaactc
gttcaaagtagaggtaatattgcagagaaacgggttatacaagaaataaaccaccttaca
tgcatcaaaaatgaaactgaattgaatgtggacagtgagagtcgatcgtttagaaaagac
atgcgggagttagctgctcaagcttgtaaggatcgagatactctacactggaaatcactt
cttcaacgccattttcctccaaccatcatcccatacctcaacgaaagtactcactactta
aaagattttggcctcattcagttaacatcagaaaattccgagacggtatacaccattaaa
atcaacccttcgtggtcaacggaacacttaacggaagtcgcactccagacttgggtttcg
aaaacaaaagctcgccttccttccaccaataaggacgattatgttttgaaaggaaatgga
aaagagtttattgttgggaatcacccaatttatatgtttaagttcttacgaaaagcactg
gtatgtaaacgtgaaggtattgtcagtagcatcaaagcacctccagttgtttctctggtt
catgttgcaagcgtgagaaaaattttaccccagcaataccaacttttaaaaaaagtacag
acgaactttgcccctcctgtgccagaaaaacatcgagcagtttggtcactatggcaactc
gatgttatgttcaaattaagaatcataagagctggtaacgtcaatgcaggccaagagagg
gacaaaaagctagtggtccacgttggtttataccatggaacagaaacgctgtgtcctacc
acctacactaaagaaccagtaaaagagatggcagcgggtaatgagtaccagtgggatgaa
gaatgtttctttgatataaatgcagttaaccttcctcgaaatgcgatgctttgtctcgct
atctgctccagcaaacgaaatgttggtgggaaatctaaaagaaaggagtcaactcaaaaa
aatactcagcattctgcatctcctattgcttgggctaatatgatggtgtttgatttcaaa
agatacctcaaagctggcttgtaccggttaaactgctggcaagtgaaccacgataatctt
gactcgaataacttgagtcctcgtggaggagtaatgcttaatccggatgttgaacaagct
gctttcatcgagataatgatgccagagtaccaagctaccatcatgtatccgtctctaccg
gaagtgttagaagaagcagctcgtcaagcagttgttcgtgaaagcaacttaatgacgcga
ggcgcttccaaatctcacatgacacaactggatgaagttgttagaaaagatcgtttcgac
gatttatttgatgacgataaaagtttgttgtggcgattacgaatcgactgtagggaaaaa
tatcctgaagctctttcaaaagttctcgcatctgcaaagtggaattcatacaagagtgtt
gccatggtgcaagcaatgctcaattcatggacacctttgtcaccggagcgcgccatggag
ctgttggattgtcagttcgccgatgaacatgtgagggacttcgctgtgaagtgtttggaa
aacttaagagatgacgaactgcaacaataccttatgcagttggttcaagttgttaagttc
gattcttacctgaacagtagtttagttcgtttcattcttcgtcgtgcttggagcaaccga
aaaatcggacattttttgttttggcatttaaaagcggaaatttcgaacacgttgttaaat
cttcgtttcgcgttgatcatggaagcttacttgtatggtaacttaccgcatgtgaagact
ttgtataaacaacaagaagcgctcaataaaatgagaactttgaatgaaagggttaaagga
tctgagtttagtcaaaaagatattaaagttcgggctcgacaggcattgaaggatacggcg
aaccaggattcatttaaagaagctcttactagtgttgaatgtcctctggaacctaacttg
gacttggaggaattacttgttgaaaaatgcaaagtcatgaacagtaaaatgagacctcta
tggttggttttcaaaaacaagcaagtacaagacggaagcatgagcgttatctacaaaaac
ggagatgatcttcgccaagatatgctgactttacaaaccatatctatcatggatatgctg
tggaaagctgaaggtttggacttgagaatgatcccgtatggttgccttgcaactgggaaa
ggcacgggcatgatagaagtagtcacgcattcaaatacaatagccaacatacagaagaca
agaggtggaaaaatgtcggcgttcagacaccaaacgttaattgaatggcttgaacagaac
aactcaaccccgtcagaatttgagcaagcaatagaaaacttcacgtactcctgtgctggt
tattgtgtggccacgtttgtgcttggtgtgggtgatcggcactctgataatattatggtc
actgagaaaggacagcttttccacattgactttgggcatattcttggaaactttaagact
aaatttggaatcaaaagagagagagttccgtttgttcttgcgcacgacttcgttcatgtt
atcaacaaagggaaaaccaacaacaaggctgatttcgatcaattccgaaaactttgtgat
aatgcattctgtattctgagaaagaagggttatctgatcattacattgtttgcgttgatg
cttcattctgggttgcctgagatgacatcgttggaccatttagaatacttgcgtgagacc
ttagccctccacttaacagaacagaaagctctgcaacaattccgcagcaagtttaataaa
gccctcactgatgcatgggctacctcagttaattggttctttcataatgtagcacgggat
aacacgtga

DBGET integrated database retrieval system