KEGG   Ciona intestinalis (sea squirt): 100183611Help
Entry
100183611         CDS       T01056                                 

Definition
phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform-like
Orthology
K00922  
phosphatidylinositol-4,5-bisphosphate 3-kinase [EC:2.7.1.153]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Inositol phosphate metabolism
FoxO signaling pathway
Phosphatidylinositol signaling system
mTOR signaling pathway
Jak-STAT signaling pathway
Module
PI3K-Akt signaling
Brite
KEGG Orthology (KO) [BR:cin00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    100183611
 Environmental Information Processing
  Signal transduction
   04630 Jak-STAT signaling pathway
    100183611
   04068 FoxO signaling pathway
    100183611
   04070 Phosphatidylinositol signaling system
    100183611
   04150 mTOR signaling pathway
    100183611
Enzymes [BR:cin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     100183611
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 1082 aa AA seqDB search
MSISRAFSGVHLGGSGGAYDEEESIYDEWGYHNSMYVSVDFFLPTGIYIPIDIPRNSTIK
EVKNLLWQEAIHHPLFSKLLNPESYTFTYITSFGLPEEIVDESRHLSEFDIFHELPVLKL
VQSRGNIAEKRVIQEINHLTCIKNETELNVDSESRSFRKDMRELAAQACKDRDTLHWKSL
LQRHFPPTIIPYLNESTHYLKDFGLIQLTSENSETVYTIKINPSWSTEHLTEVALQTWVS
KTKARLPSTNKDDYVLKGNGKEFIVGNHPIYMFKFLRKALVCKREGIVSSIKAPPVVSLV
HVASVRKILPQQYQLLKKVQTNFAPPVPEKHRAVWSLWQLDVMFKLRIIRAGNVNAGQER
DKKLVVHVGLYHGTETLCPTTYTKEPVKEMAAGNEYQWDEECFFDINAVNLPRNAMLCLA
ICSSKRNVGGKSKRKESTQKNTQHSASPIAWANMMVFDFKRYLKAGLYRLNCWQVNHDNL
DSNNLSPRGGVMLNPDVEQAAFIEIMMPEYQATIMYPSLPEVLEEAARQAVVRESNLMTR
GASKSHMTQLDEVVRKDRFDDLFDDDKSLLWRLRIDCREKYPEALSKVLASAKWNSYKSV
AMVQAMLNSWTPLSPERAMELLDCQFADEHVRDFAVKCLENLRDDELQQYLMQLVQVVKF
DSYLNSSLVRFILRRAWSNRKIGHFLFWHLKAEISNTLLNLRFALIMEAYLYGNLPHVKT
LYKQQEALNKMRTLNERVKGSEFSQKDIKVRARQALKDTANQDSFKEALTSVECPLEPNL
DLEELLVEKCKVMNSKMRPLWLVFKNKQVQDGSMSVIYKNGDDLRQDMLTLQTISIMDML
WKAEGLDLRMIPYGCLATGKGTGMIEVVTHSNTIANIQKTRGGKMSAFRHQTLIEWLEQN
NSTPSEFEQAIENFTYSCAGYCVATFVLGVGDRHSDNIMVTEKGQLFHIDFGHILGNFKT
KFGIKRERVPFVLAHDFVHVINKGKTNNKADFDQFRKLCDNAFCILRKKGYLIITLFALM
LHSGLPEMTSLDHLEYLRETLALHLTEQKALQQFRSKFNKALTDAWATSVNWFFHNVARD
NT
NT seq 3249 nt NT seq  +upstreamnt  +downstreamnt
atgagtatttctcgtgcattttcaggcgtccacctggggggaagtggaggtgcttatgac
gaagaggaatctatatatgatgaatggggttaccacaactctatgtatgttagtgtagat
ttctttctaccaacaggaatctacataccaattgatataccaaggaattcaaccataaaa
gaagtgaaaaatttactatggcaagaagcaatccaccatcctttattcagcaagcttctt
aaccctgaaagttacactttcacatacataacaagttttggtttaccagaggaaattgtt
gatgagagtcggcatctcagtgagtttgatattttccatgaactgccggtgttgaaactc
gttcaaagtagaggtaatattgcagagaaacgggttatacaagaaataaaccaccttaca
tgcatcaaaaatgaaactgaattgaatgtggacagtgagagtcgatcgtttagaaaagac
atgcgggagttagctgctcaagcttgtaaggatcgagatactctacactggaaatcactt
cttcaacgccattttcctccaaccatcatcccatacctcaacgaaagtactcactactta
aaagattttggcctcattcagttaacatcagaaaattccgagacggtatacaccattaaa
atcaacccttcgtggtcaacggaacacttaacggaagtcgcactccagacttgggtttcg
aaaacaaaagctcgccttccttccaccaataaggacgattatgttttgaaaggaaatgga
aaagagtttattgttgggaatcacccaatttatatgtttaagttcttacgaaaagcactg
gtatgtaaacgtgaaggtattgtcagtagcatcaaagcacctccagttgtttctctggtt
catgttgcaagcgtgagaaaaattttaccccagcaataccaacttttaaaaaaagtacag
acgaactttgcccctcctgtgccagaaaaacatcgagcagtttggtcactatggcaactc
gatgttatgttcaaattaagaatcataagagctggtaacgtcaatgcaggccaagagagg
gacaaaaagctagtggtccacgttggtttataccatggaacagaaacgctgtgtcctacc
acctacactaaagaaccagtaaaagagatggcagcgggtaatgagtaccagtgggatgaa
gaatgtttctttgatataaatgcagttaaccttcctcgaaatgcgatgctttgtctcgct
atctgctccagcaaacgaaatgttggtgggaaatctaaaagaaaggagtcaactcaaaaa
aatactcagcattctgcatctcctattgcttgggctaatatgatggtgtttgatttcaaa
agatacctcaaagctggcttgtaccggttaaactgctggcaagtgaaccacgataatctt
gactcgaataacttgagtcctcgtggaggagtaatgcttaatccggatgttgaacaagct
gctttcatcgagataatgatgccagagtaccaagctaccatcatgtatccgtctctaccg
gaagtgttagaagaagcagctcgtcaagcagttgttcgtgaaagcaacttaatgacgcga
ggcgcttccaaatctcacatgacacaactggatgaagttgttagaaaagatcgtttcgac
gatttatttgatgacgataaaagtttgttgtggcgattacgaatcgactgtagggaaaaa
tatcctgaagctctttcaaaagttctcgcatctgcaaagtggaattcatacaagagtgtt
gccatggtgcaagcaatgctcaattcatggacacctttgtcaccggagcgcgccatggag
ctgttggattgtcagttcgccgatgaacatgtgagggacttcgctgtgaagtgtttggaa
aacttaagagatgacgaactgcaacaataccttatgcagttggttcaagttgttaagttc
gattcttacctgaacagtagtttagttcgtttcattcttcgtcgtgcttggagcaaccga
aaaatcggacattttttgttttggcatttaaaagcggaaatttcgaacacgttgttaaat
cttcgtttcgcgttgatcatggaagcttacttgtatggtaacttaccgcatgtgaagact
ttgtataaacaacaagaagcgctcaataaaatgagaactttgaatgaaagggttaaagga
tctgagtttagtcaaaaagatattaaagttcgggctcgacaggcattgaaggatacggcg
aaccaggattcatttaaagaagctcttactagtgttgaatgtcctctggaacctaacttg
gacttggaggaattacttgttgaaaaatgcaaagtcatgaacagtaaaatgagacctcta
tggttggttttcaaaaacaagcaagtacaagacggaagcatgagcgttatctacaaaaac
ggagatgatcttcgccaagatatgctgactttacaaaccatatctatcatggatatgctg
tggaaagctgaaggtttggacttgagaatgatcccgtatggttgccttgcaactgggaaa
ggcacgggcatgatagaagtagtcacgcattcaaatacaatagccaacatacagaagaca
agaggtggaaaaatgtcggcgttcagacaccaaacgttaattgaatggcttgaacagaac
aactcaaccccgtcagaatttgagcaagcaatagaaaacttcacgtactcctgtgctggt
tattgtgtggccacgtttgtgcttggtgtgggtgatcggcactctgataatattatggtc
actgagaaaggacagcttttccacattgactttgggcatattcttggaaactttaagact
aaatttggaatcaaaagagagagagttccgtttgttcttgcgcacgacttcgttcatgtt
atcaacaaagggaaaaccaacaacaaggctgatttcgatcaattccgaaaactttgtgat
aatgcattctgtattctgagaaagaagggttatctgatcattacattgtttgcgttgatg
cttcattctgggttgcctgagatgacatcgttggaccatttagaatacttgcgtgagacc
ttagccctccacttaacagaacagaaagctctgcaacaattccgcagcaagtttaataaa
gccctcactgatgcatgggctacctcagttaattggttctttcataatgtagcacgggat
aacacgtga

DBGET integrated database retrieval system