KEGG   Ciona intestinalis (sea squirt): 100183713Help
Entry
100183713         CDS       T01056                                 

Definition
glycogen [starch] synthase, muscle-like
Orthology
K00693  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:cin00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    100183713
Enzymes [BR:cin01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     100183713
Glycosyltransferases [BR:cin01003]
 Polysaccharide
  Storage polysaccharide
   100183713
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
11
AA seq 689 aa AA seqDB search
MAEEAPALFTFEVALEVANKVGGIYTVLRSKAESTVEELGEDYCMIGICNERFVAMEVEK
MEPSLPQMKRAVDLMREKHIGVVTGRWLIEGYPKVVLFNLDTAWDMYNTWSWEMFDKTGV
GIPEHDTEAKRCVLFGFLTAWFLGEFRAQCGKKSVIVAQFHEWLSGIGLLMCRMRQIDIS
TIFTTHATLLGRYLCAANVDFYNNLSNFQVDIEAGNRQIYHRYCMERAAAHSAHVFATVS
DITSLEAEHLLKRKPDLILPNGLSIKNAQCMHEFQNLHAIAKEKIHHFVRGHFYGHFDLN
LDKTLYMFIAGRYEYSNKGADLYIEAMSRLNHRLKMINSDVTVIAFLIFPASTNNFNVES
LKGQAVVKQLKETVDVIKDDIGNKLFDLCLRGKLPNEEQLLDRDHVIKLKRCMYANQCST
LPPIVTHNMTDDANDPILKQIRECKLFNARSDRVKLIFHPEFLSQTSPLLSMDYDEFVRG
CHLGVFPSYYEPWGYTPAECAIKGIPSVTSNLSGFGCFMQSHLSDPEAYGIYIVDRRFKN
VDETCNQLTDYLYHFCRMTRRERIIQRNRTERISEYLDWSRLGMYYTNARRLAIDRTHPE
FLEQTRSFSPTGSVRLPRPYSAPSSPFGSRIASPYQSDEEDNKVFDDDDGDSGLHTSNLI
STDTESVLSTATTPNGTGNDVISSTASDL
NT seq 2070 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagaagccccagcgttgttcacctttgaggtggctcttgaggtcgcaaataaa
gttggaggaatctacactgtccttcggagcaaagcagagtcgaccgtcgaggaactggga
gaggattattgtatgattggaatctgtaacgagagatttgtcgcgatggaagtcgaaaaa
atggagccatctttaccccagatgaaacgggctgtggatctgatgagggaaaaacatata
ggggttgtaactgggcgttggcttatagaaggataccccaaggttgttttgtttaacttg
gacacagcatgggacatgtacaacacatggtcatgggaaatgttcgataaaactggtgtt
ggtatcccagaacatgatactgaggctaaaagatgcgttttgttcggatttctgaccgca
tggttcctcggagagttccgtgctcaatgtggcaagaaatcagtgatcgtggcacaattt
cacgaatggttgtcgggtattggcctccttatgtgccggatgcgtcaaattgatatctcc
accattttcaccacccatgctacattgttgggacgatacttgtgtgctgctaatgttgat
ttctacaacaatttaagcaatttccaagttgacatagaggcagggaaccgtcaaatatac
cacagatactgcatggaaagagcagctgcccattctgctcatgtattcgccacagtatcc
gacataacttcactagaagctgaacatctgcttaaacgaaaaccagatttaattcttcca
aatggattgagcataaagaatgcacagtgtatgcatgagtttcaaaatctacacgcgatt
gcaaaagaaaaaattcaccattttgtcagaggtcatttttatgggcattttgacctcaat
ttggataaaacactgtacatgttcattgctggtagatatgaatacagcaacaaaggtgca
gacctttacattgaagctatgagccgacttaaccacagattaaagatgataaacagtgat
gtgacagtgattgcttttctaatattccctgcatcaactaacaacttcaacgtagaaagt
ttaaaaggccaagcagtggtgaaacaactcaaagagacagttgacgtcattaaggacgac
attggaaacaaacttttcgatctatgtttgagagggaaacttcctaatgaggagcagtta
ctcgaccgcgaccacgttattaaactcaaacgatgtatgtacgcaaaccagtgtagtact
ttaccccccatcgttacccacaatatgactgatgacgcaaatgacccaatcctcaaacaa
atccgtgagtgcaaattattcaacgcacgcagtgaccgtgttaaactcattttccacccg
gagtttctttcgcaaacctcccccttgttatccatggattacgacgagttcgtccgtggg
tgtcacctcggggtattcccctcctactacgagccatggggctacacgccagcggagtgc
gccatcaaaggcatcccgagcgtgacgagcaacctcagtggtttcggatgtttcatgcag
agtcatcttagcgatccggaggcatacgggatctacatcgtggatcgaaggtttaaaaac
gtcgacgagacgtgcaatcaactcaccgattacctctaccatttctgtcgaatgactcgt
agagagagaattattcagcgaaatcgaacggagcgaatcagcgaatatcttgattggtca
cgactcggcatgtattacacgaatgctcgacgtttggcgattgatcgaacacacccagaa
tttctcgaacaaacaagatctttttcaccgactggttcagtccgtctaccacgtccgtac
tccgctccaagttccccgtttggttcacgcatagcttcaccttaccaatcagatgaagag
gataataaggtgtttgacgacgatgacggagacagcggactccacacctcaaaccttatt
tccacggatacagaaagtgttctctcaacggctaccactccaaatgggacggggaatgat
gtgataagttcgaccgcttcggatttgtaa

DBGET integrated database retrieval system