KEGG   Ciona intestinalis (sea squirt): 100183961Help
Entry
100183961         CDS       T01056                                 

Definition
glucosylceramidase-like
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:cin00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    100183961
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    100183961
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100183961
Enzymes [BR:cin01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     100183961
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
8
AA seq 512 aa AA seqDB search
MIRFLFAFVVIIQSALSEPCVPRDYGHESFVCVCNATYCDTLLTNRPVPLNSVSVYTTSK
SKSRFDFSLEQLQKAQGFSTVQPTITVTDEKVFQTIKGFGGAATDAATINIKSLSSKTQD
QLIASYFGPLGIEYNIIRVPIASCDYSTREYTYLDTPNDFNLSTFALAKEDINYKIPILK
SAFAMSKNNLSLYGSPWTAPAWLKTSDNEIGRGWLQGQAGDKYHKTWAEYFTRFLDEYKK
HGIEFWGLTVQNEPSNGLLVKSSWQSTGFTAEMQRDFVKMDLGPALRKHGYGNIKLMILD
DQRLFLPAFPEVVLADKEAAQYVSGIGVHWYWDWLIGPDVLDDTHNKFPDTFILGTEACN
KDSPQPDLGKWDTGVKYSNSILDNLNNWAVGWVDWNMCLDLQGGPNWANNFDDSPVIANA
TADEFYKQPMFYHLGHFSKFLVEGSVRIHSTGTDLPSDIKYVAAKTPSGSFVLVVLNTSA
DDVPITVVANESMFNVTSPADSIQTFTWSKYQ
NT seq 1539 nt NT seq  +upstreamnt  +downstreamnt
atgattcgctttttgtttgcattcgtcgttataatacaaagtgctttgtccgaaccatgc
gtacctcgagattatgggcacgagtcgttcgtctgcgtttgcaatgctacatattgtgac
actctgcttacaaaccgaccggtaccattgaactcggtaagtgtgtacacaacatcaaaa
agtaaatcaagatttgatttttcactggaacaacttcaaaaagcacaaggcttttcgact
gtccaaccaactattacagtaaccgatgagaaagtttttcagaccatcaaaggctttggt
ggcgctgctactgatgctgcaaccattaatattaagtctctgagctctaagacacaagat
cagttaattgctagttattttgggcctttgggaattgaatataatattataagagtacct
atcgcaagttgcgattattctacacgagaatacacctacctggatactccgaacgatttt
aatctttctactttcgcattagctaaggaagatataaactacaaaattccgattttgaaa
tcggcatttgcaatgtccaaaaataacctttctctttatggaagcccatggactgcacca
gcttggttaaaaacttctgataatgagattggtaggggttggttacaaggacaagcagga
gataaataccataaaacatgggccgagtatttcacacgatttttggacgaatataaaaag
catggtatcgaattttggggcttaactgttcaaaatgaaccttcaaatggacttctggta
aagagtagttggcagtctactggtttcactgcagaaatgcagagagattttgtaaaaatg
gacctgggtcctgcattgagaaaacatggatatggaaatattaaactgatgattttagat
gaccaacgactctttttgccagcttttcctgaagttgttcttgcagataaagaagcagca
cagtatgtttctggtattggtgtccattggtattgggactggcttattggacctgatgtg
ttagatgacacacataataagtttcctgatacatttattcttggcacagaagcatgtaac
aaggacagtccacagcctgatttaggaaaatgggacacaggagtaaaatacagcaacagt
attcttgataaccttaataactgggctgttggttgggtagattggaacatgtgtcttgat
ttacaaggaggcccaaactgggccaacaattttgacgacagtcctgtaattgccaatgca
actgcagacgaattctacaagcaacctatgttttatcacttgggacatttcagcaaattt
ttggtagaaggttcagtgagaattcattctactggcactgacctaccgagtgatatcaaa
tatgtggctgcaaaaaccccaagtggtagctttgtccttgtggttctcaacacatcagct
gatgatgttcctattacagtggttgctaatgaaagcatgtttaatgtaacaagcccagca
gattctattcaaactttcacttggtcaaagtatcaataa

DBGET integrated database retrieval system