KEGG   Ciona intestinalis (sea squirt): 100184010Help
Entry
100184010         CDS       T01056                                 

Definition
mRNA export factor-like
Orthology
K14298  
mRNA export factor
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
RNA transport
Class
Genetic Information Processing; Translation; RNA transport [PATH:cin03013]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1
AA seq 361 aa AA seqDB search
MSVFGNTSSSFSFGASNTTTNHNPMKDIEVTSPPDDSISCLEFSPATLPGNFLIAGSWAN
DIRCWQIEDNGQTVPKAQQMHQGPVLDVSWSDDGTKVFTASADKTAKMWDLAANQATQVA
QHDAPIKTCHWIKSPNYSCLMTGSWDKTVKFWDTRSSSPMKAITLNERVYCADVVYPMAM
VSCADKKLVCLKLESEPQEYQKFDSPLKYQHRCISIFKNKMQSSPVGFALGSIEGRVAIH
YIQPSSPRDNFTFKCHRSTPTQPQEIHVVNSIAFHPTFGTLATVGSDGKYSFWDKDARTK
LKGSEQLPQSISACAISHNGNIFAYASSYDWSKGHEHYNPQQKNYIFLKNCAEDMKPRAK
K
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtattcggaaataccagttcatcgttttcgttcggggcctcgaacacgaccacc
aaccataaccctatgaaagatattgaagtaacttctccaccagacgacagtataagttgt
cttgaattcagtcccgctaccttgcctgggaacttccttatagcaggttcatgggctaac
gacatacgatgctggcagattgaggataatggccaaactgtcccgaaagctcaacaaatg
catcaagggccagttctggatgtttcctggagtgacgacggcacaaaagttttcacggct
tctgctgataaaactgcgaaaatgtgggatcttgcggcaaaccaagccacccaagttgct
cagcacgatgctcccataaaaacttgtcattggattaaaagtccgaactactcatgcctt
atgacggggagttgggacaagactgtgaaattttgggacactcgttcatcctctccaatg
aaagcaataactctaaacgagcgcgtttattgcgctgatgttgtctacccaatggcaatg
gtaagctgcgcagataaaaagttggtctgtttaaaacttgaaagcgagcctcaagaatac
cagaagtttgactcaccgctaaagtaccagcatcgctgtattagtattttcaagaacaaa
atgcagtcttcccctgtcgggtttgcacttggtagtatagaagggagggtagccatccac
tacatacagcccagcagcccgcgtgataacttcaccttcaaatgccaccgttcaaccccc
acacaaccacaggagattcacgtcgtcaattcaatcgcgttccacccaacatttggcacg
cttgctacagttggctcagacgggaaatacagtttctgggacaaagatgcgagaacaaaa
ctcaaaggttcagaacagctcccccagtctatatcagcgtgtgccatcagtcataatggg
aatattttcgcatatgcgtcaagttacgactggtcaaaaggacatgagcattataaccct
caacagaagaactacatcttcttgaagaactgtgcggaggacatgaaaccaagagcaaaa
aaatga

DBGET integrated database retrieval system