KEGG   Ciona intestinalis (sea squirt): 100184010Help
Entry
100184010         CDS       T01056                                 

Definition
(RefSeq) mRNA export factor-like
  KO
K14298  mRNA export factor
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
cin03013  RNA transport
Module
cin_M00427  Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:cin00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    100184010
Messenger RNA biogenesis [BR:cin03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    Nuclear pore complex
     100184010
Chromosome and associated proteins [BR:cin03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    100184010
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WD40 ANAPC4_WD40 Nup160
Motif
Other DBs
NCBI-GeneID: 100184010
NCBI-ProteinID: XP_002124903
Ensembl: ENSCING00000006244
UniProt: F6YBW7
Position
1
AA seq 361 aa AA seqDB search
MSVFGNTSSSFSFGASNTTTNHNPMKDIEVTSPPDDSISCLEFSPATLPGNFLIAGSWAN
DIRCWQIEDNGQTVPKAQQMHQGPVLDVSWSDDGTKVFTASADKTAKMWDLAANQATQVA
QHDAPIKTCHWIKSPNYSCLMTGSWDKTVKFWDTRSSSPMKAITLNERVYCADVVYPMAM
VSCADKKLVCLKLESEPQEYQKFDSPLKYQHRCISIFKNKMQSSPVGFALGSIEGRVAIH
YIQPSSPRDNFTFKCHRSTPTQPQEIHVVNSIAFHPTFGTLATVGSDGKYSFWDKDARTK
LKGSEQLPQSISACAISHNGNIFAYASSYDWSKGHEHYNPQQKNYIFLKNCAEDMKPRAK
K
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgtcggtattcggaaataccagttcatcgttttcgttcggggcctcgaacacgaccacc
aaccataaccctatgaaagatattgaagtaacttctccaccagacgacagtataagttgt
cttgaattcagtcccgctaccttgcctgggaacttccttatagcaggttcatgggctaac
gacatacgatgctggcagattgaggataatggccaaactgtcccgaaagctcaacaaatg
catcaagggccagttctggatgtttcctggagtgacgacggcacaaaagttttcacggct
tctgctgataaaactgcgaaaatgtgggatcttgcggcaaaccaagccacccaagttgct
cagcacgatgctcccataaaaacttgtcattggattaaaagtccgaactactcatgcctt
atgacggggagttgggacaagactgtgaaattttgggacactcgttcatcctctccaatg
aaagcaataactctaaacgagcgcgtttattgcgctgatgttgtctacccaatggcaatg
gtaagctgcgcagataaaaagttggtctgtttaaaacttgaaagcgagcctcaagaatac
cagaagtttgactcaccgctaaagtaccagcatcgctgtattagtattttcaagaacaaa
atgcagtcttcccctgtcgggtttgcacttggtagtatagaagggagggtagccatccac
tacatacagcccagcagcccgcgtgataacttcaccttcaaatgccaccgttcaaccccc
acacaaccacaggagattcacgtcgtcaattcaatcgcgttccacccaacatttggcacg
cttgctacagttggctcagacgggaaatacagtttctgggacaaagatgcgagaacaaaa
ctcaaaggttcagaacagctcccccagtctatatcagcgtgtgccatcagtcataatggg
aatattttcgcatatgcgtcaagttacgactggtcaaaaggacatgagcattataaccct
caacagaagaactacatcttcttgaagaactgtgcggaggacatgaaaccaagagcaaaa
aaatga

DBGET integrated database retrieval system