KEGG   Ciona intestinalis (sea squirt): 100184124Help
Entry
100184124         CDS       T01056                                 

Definition
protein kinase, cGMP-dependent, type I-like
Orthology
K07376  
protein kinase, cGMP-dependent [EC:2.7.11.12]
Organism
cin  Ciona intestinalis (sea squirt)
Brite
Enzymes [BR:cin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.12  cGMP-dependent protein kinase
     100184124
Protein kinases [BR:cin01001]
 Serine/threonine protein kinases: AGC group
  PKG family
   100184124
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
12
AA seq 1256 aa AA seqDB search
MDYQYDLRHKVLLKDERIRELECILAEKDEEIEELKAKLDKFQSIFPTATQQRHLGTFGA
GMPRTQRAQGISAEPNLVIGDPSLAQVRTYAKSEKRSLSEIKEKEEVIKALEADLGEKIS
IIQCLHCQLDKYRSIVRSRFRPRWSNNSGSSKEPLQFSDETNPLGEPVIEISRPKEPTEA
NLFSATSDTGTFGSSLTPSTNKRPSTASSGSVFFSSIPENSNVVDSKQRNGRRSEFVSVS
SHSLLSPRVPLAAKERSPKASIAEDKQYSEDTTIRPRDTESVTMAREGEEDHLSTKTTQR
KKSSVHTWLKKHAKWRKKANTNSSRTNSETAGTSSLESDAISISSEKGSAKRRNSFWKRG
LSYVRSTKSHGVKTTSPHCLPQLSVSSASNPFIQPYAYHHQPSLVTVAVQTSPVMVGFPY
HGGRAGFFSSDAEQQQYNFQRWRERADYIQHINAQQIMMANLQQAAVIAEQQRTQAAAAS
FRPRFCSERVQSSWERGESLDMLPGKRTYPMDVEMSSMPLEQSELAEYASCEVITGMEAN
SAKVAEIKDVSSCVQMKDMTNKTMSDETTSGLMTPPTVSPVHKSAESAVAVNGFTPERVS
PVHTKNNHTNVIIRSPIKTKLGRKEQTPKITSPMHDPGQKRLKRNAISAEPSSLNAVGQA
DFDKSHRLVPKLPQTKTLIRQAILENDFMKHLEDCQIEEIVDCMYPVEYSNGSCIIKEGD
VGSLVYVLEDGKVAVTKAGAHLCNMGEGKVFGELAILYNCTRTATVKATTNVRLWAIDRH
CFQAIMMRTGLLKHTEYLEFLTSVPTFSKLDEDLLRRIVDVMEECHFEYGDYIIRQGAIG
DTFYIISKGNVQVTKRKSASSEPVVIRKLAKGDWFGERALQGEDMRTANVVVDDTEGVTC
LVIDRQSFTQLIGDLDSVKQKKYDEVPVQNSKSDGFYVGLTLEDFTAIDTLGVGGFGRVE
LVELKNDITKTYAMKVLKKRHIVDTRQQEHIKNEKAIMMECQSDFIVKMYRTFRDTKYIY
MLLECCLGGELWTVLRDKGHFDDSAARFYTGCVVEAFTYMHSRGIIYRDLKPENLLLDTR
GYAKLVDFGFAKRIGFSRKTWTFCGTPEYVAPEIILNKGHDLSADYWSLGILMYELMTGS
PPFSGSDPMKTYNQILKGIDMIEFPKKISKNAQSLIRKLCRDNPSERLGNQRNGIKDIQK
HKWFDGFHWVGLRKGSMSPPIKPQVSSSSDSSNFDKFPEDEEEPPPDDLSGWDVDF
NT seq 3771 nt NT seq  +upstreamnt  +downstreamnt
atggactaccaatatgaccttcgtcataaagtgcttctaaaagatgaaagaatacgagaa
ttggaatgtattctcgcagagaaagacgaagaaattgaagaactgaaagcaaaacttgat
aaatttcagtctatatttccaacggccactcagcagcgacacctggggacgtttggagca
ggaatgccacgaacacagagggcgcaagggatcagcgctgaaccaaatcttgttataggc
gatccttcgctggcacaagttcgcacttatgcaaaatccgaaaagcgcagtttgagcgag
ataaaagaaaaagaggaggtgataaaggcactggaagccgacctgggtgaaaaaatttct
atcatacagtgtttgcattgccagttggataagtatagatctatagtacgttcacggttt
cggccgaggtggtcaaataactctggttcttctaaagaaccgcttcagttttcagatgaa
actaacccattgggggaaccagtgattgaaatatccagacctaaagaaccaactgaggcg
aatttgttttcagcgacctcagacacaggcacatttgggagcagccttacgccgagtaca
aacaagagaccaagtacagcttcgtctggttctgtatttttctcatcgattccagaaaac
tcgaatgttgttgactctaaacagagaaacggtcgtagaagcgagtttgtaagcgtatcg
tcgcacagtttgttgtcgccacgagttccacttgcagcaaaagaaaggtcacccaaagca
tctattgcagaagacaaacagtatagtgaggatacgacgatacgtccacgggacacagag
tcagtgacgatggcccgggaaggagaagaagatcatctttcaacaaaaacaacccaacgt
aagaaatccagtgtccacacgtggttgaagaaacacgccaaatggcgcaagaaagcaaat
acgaatagcagcagaacaaacagtgagactgcgggcacgtcaagcctcgagagtgatgca
atttctatttcttcggaaaagggttcagcaaaaagacggaacagcttttggaagcgcggt
ctgtcttatgttaggtcgacgaaatcacacggtgttaaaaccacaagcccacactgcttg
ccgcaactttccgtgtcttccgcctcgaacccatttatccaaccttacgcctaccaccat
cagccctcactggtcacggttgccgtccagacgtcgccggttatggtaggatttccctac
catggtggtagggctggtttctttagctctgacgccgagcagcagcagtataacttccaa
cgatggcgggagagggctgactacatacagcacatcaatgcgcagcaaattatgatggcg
aacttgcaacaagcagctgtaattgctgaacaacagcgaacacaggccgctgccgcgtca
ttccggccgcgtttttgctccgaaagagttcagagttcatgggagcgcggcgagtcgctg
gatatgcttccgggcaagcgaacttatccgatggatgtggaaatgtcgagcatgccgctc
gaacaaagcgagttagccgaatatgcgagttgtgaggtcattacaggaatggaagcaaac
tcggcaaaggttgcggagatcaaggatgttagcagttgtgttcaaatgaaagatatgaca
aacaaaaccatgtcggatgaaactacaagtggtcttatgacacctcctaccgtttctccc
gttcataaaagcgccgagtcggctgttgcggttaacggtttcacccccgagcgagtatca
ccggttcataccaagaacaaccacacgaatgtgataataagaagcccaattaagacgaaa
ctcggcaggaaagagcaaactccaaagataacttcaccaatgcacgaccctgggcaaaaa
cgtttaaaacgaaacgcgatctcagccgagccaagcagtttaaatgctgtcgggcaagct
gacttcgacaagtcacacagactagtcccgaaactaccacaaacgaaaaccttaatacgt
caagccattttggaaaatgacttcatgaaacatctagaagattgccagatcgaagaaata
gtggattgcatgtaccctgtcgaatacagcaatgggagttgtattatcaaggagggtgac
gtcggatctctggtttacgttctcgaagatggtaaagtcgctgttacgaaggctggcgca
catctatgcaacatgggagaagggaaagtgtttggcgaactagctatactctacaactgc
acacgcacagctacagttaaagcaacaacgaacgtcagattatgggccatagaccgacat
tgtttccaagccataatgatgcgaacagggttgctaaaacacacagagtatctggagttc
cttaccagcgtcccaacgttttcaaagttggatgaagatttactgcgacgtattgttgac
gtcatggaagagtgccacttcgagtacggtgattacattatccgccagggggcgataggc
gacaccttctacatcataagcaaaggcaatgtccaagtaacgaagcgtaaaagtgcgtcc
agcgaaccagttgtcatacgtaagctggctaaaggtgactggtttggagaaagagctttg
caaggtgaggatatgcgaacagcgaatgtggttgttgacgatacggaaggagtcacgtgt
cttgtgattgacaggcagtcgttcacgcaactcatcggagacctggacagcgttaaacag
aaaaaatacgacgaagtaccagtacaaaactcaaaatctgacggtttttacgttggactg
acactggaagacttcactgcgattgacaccctgggagttggcggttttgggagagttgag
ctggtggagctaaagaacgacattacaaaaacttacgctatgaaagttttgaaaaagcgc
cacattgtagacactcgacagcaagaacatataaagaacgaaaaagcgataatgatggaa
tgccagtctgattttatcgtcaaaatgtaccgaactttccgcgacaccaaatacatttat
atgttgttggaatgttgtttgggtggcgagctgtggacggtgctacgagataaaggccac
ttcgatgactcggctgcaagattttatactggctgcgtagtggaggcatttacgtatatg
cattcacgtggcatcatatacagggacttgaaaccagaaaatcttttactcgacacgcgg
ggatatgcaaaactggtcgacttcgggttcgcaaagcggataggttttagtcggaaaact
tggacattttgtggaactcccgaatatgtagctccggaaattattctgaacaagggccac
gacctatcggcggattactggtcacttgggatcctaatgtatgaactaatgaccggcagt
ccgcctttttcgggttctgatccaatgaaaacatacaaccagatattaaaaggaatcgac
atgattgaattcccgaagaaaatatctaagaacgcacaaagtcttatacgtaaactatgc
agggataacccctctgaaagactgggcaaccaacggaatggaatcaaagatattcaaaaa
cacaaatggtttgatggtttccattgggttggcttgcgcaaaggaagtatgtcaccgccc
atcaaacctcaggtttccagctcgtctgactcttctaacttcgataaattcccggaggac
gaagaggagcctcctcccgatgatctttccgggtgggacgtggatttctga

DBGET integrated database retrieval system