KEGG   Ciona intestinalis (sea squirt): 100184138Help
Entry
100184138         CDS       T01056                                 

Definition
putative serine/threonine-protein kinase C05D10.2-like
Orthology
K08293  
mitogen-activated protein kinase [EC:2.7.11.24]
Organism
cin  Ciona intestinalis (sea squirt)
Brite
Enzymes [BR:cin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     100184138
Protein kinases [BR:cin01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   100184138
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 629 aa AA seqDB search
MSNDIDPHITEKYEIKRRLGKGAYGIVWKALDRRTGEIVALKKIFDAFRNCTDAQRTFRE
IMFLQEFGDHSNVIKLLNVMKADNDRDIYLVFEFMDTDLHAVIKKGNILKDIHKRYIMYQ
LLKATMYMHSGNVIHRDHKPSNILLDSDCFVKICDFGLARSLTQLKESEQPGGNPALTEY
VATRWYRAPEILLASPRYTKGVDMWSVGCILGELLMGKPLFPGSSTLNQIERIMSSIPRP
TKADVDSIHSEYGHSILDRASMRPRKHLRDLIPDAPEDALDLMENLLVFNPEKRLSAKEC
LSHPYVAKFHSSREESVLDYDVLPPLDDDIQLSVAEYRCKLYEMILERKTMARRQRRAVL
HEKQQQNKQKNSDEIIEEVTKQKRVETPPPAEPRNVSHPSKPGLVHNMAHNYENQHTTHH
NGYQPQPQPQRHHYQVTAAGDKPHLGYHSNGSTPEKKYQMNGSHQKQGQYGVAFGRTVKM
GSPQQTNQRKAYRAQSAGKPVQRQDSFDGPSLKHRQQSAPSQPVNGTRSRSLRQQFNADH
GHKLLTRQDNPTINVSRMNPVQRPSSAIAGQSSGMQATTPPRAGRKQVSGMNKNISSSGS
PKQRLGSYAQSYSVINQSALTAIGAGGRK
NT seq 1890 nt NT seq  +upstreamnt  +downstreamnt
atgagtaacgacattgatcctcatattactgaaaaatatgaaattaaaagaagattgggg
aaaggggcgtatggtattgtatggaaggcacttgacagaagaactggagaaattgtcgcc
ttgaagaaaattttcgatgctttccgaaactgcacagatgctcaaagaactttccgtgaa
atcatgtttttacaggagtttggggaccattccaatgttattaaactacttaacgtgatg
aaggcggataacgacagagatatttacctcgtgtttgagtttatggatactgacctacac
gctgttataaaaaaggggaatatattaaaagacatccacaagcgatatataatgtaccaa
ctacttaaagctaccatgtatatgcattcggggaatgtaatacatagagatcacaagcca
tccaatatcctcctggacagtgattgtttcgtcaaaatttgcgactttggtctcgcacgg
tcgctcacgcagctcaaggaatccgaacaacccggtggtaaccccgccctcaccgaatat
gtggccactaggtggtacagagcgccggagatccttctcgcttcacccagatacaccaag
ggagttgacatgtggtcagtaggttgtatactaggcgagctacttatgggaaaaccacta
ttccctggttcttctacgttaaaccagatagaaaggatcatgagctccataccacgcccg
acaaaagctgatgtagattccattcattcagagtacggacattctatattggatcgcgct
agtatgagacctcgcaaacatcttcgcgacctgatccctgacgcaccagaagacgcttta
gacttgatggagaatcttctcgtgtttaacccagagaaacgactatcagcaaaggaatgt
ctttcacatccatatgttgcaaagttccacagttcacgagaggagagcgtcctcgattac
gacgtactcccaccactagatgatgatatacagctcagtgttgccgagtacagatgcaaa
ctttacgagatgatactggaacgtaaaacaatggctcgaagacaacgcagggcagtgtta
catgaaaaacaacaacagaacaaacaaaagaattctgatgaaataattgaagaagttacg
aaacagaaacgagttgaaaccccccctcctgcggaacctagaaatgtaagccaccctagt
aagccagggttggtccataacatggcacacaactatgagaaccagcacactacccaccat
aatggttaccaaccccaaccccaaccccaacgccaccattaccaagtaaccgcagctggc
gataaaccacaccttggttaccattcaaatggttcaacaccagagaaaaaataccagatg
aatggttcacaccagaagcagggtcagtacggtgttgcattcggtcgtactgtaaagatg
ggttcacctcaacaaactaaccaaagaaaagcatacagagctcaaagtgctggtaaacct
gtgcagaggcaagacagcttcgatgggccaagtttgaaacaccgtcaacaatcggcccca
tcgcaacccgtgaacgggactcgatcacgatcgctacggcaacagttcaacgctgatcat
ggtcacaaactactcacgagacaagacaaccccacaatcaacgtttctagaatgaaccca
gtccagcgtccaagctcagccatagcaggccaatcatctggtatgcaagccaccacccca
ccccgcgcgggacgtaaacaagtgtccggcatgaacaagaacatttcatcttctgggagc
cccaagcagcgtcttggcagttacgctcagtcttattcggtcatcaatcaatcagcgctc
accgctatcggcgctggaggtcggaaatag

DBGET integrated database retrieval system