KEGG   Ciona intestinalis (sea squirt): 100184178Help
Entry
100184178         CDS       T01056                                 

Definition
(RefSeq) voltage-dependent calcium channel subunit alpha-2/delta-3-like
Organism
cin  Ciona intestinalis (sea squirt)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Position
1
AA seq 1185 aa AA seqDB search
MKLKTWSIRVQYFLVTFLSLSLHMQWICTTCFAVSLGAQASNNELAQSFGAALNVKATLY
SGYAAMQSTYENRLNAGVFTVHRLNGTKLIKTMAADLEKMLNRKRLAVERLVQVAERHAA
KYDWDKEPSDEYNNIQYINAPEPSNIEEDDYASLRKQMQFKSDARFERDVNKNTSIVQVP
FNVYSKGTKLLKSVGWSKALNQQFKRNLELEPSLKWQYFGSTEGYIRVYPGFQWRMRAGP
HDQLNIYDCRTRLWYTQSSTYPKDMIILLDRSGSMKGLKKSIAIDAVSALLDTLGDNDFF
NVLTFSKKVIPVDPCYNSTLMRADRTNKENVLTRLRDMETSDIANFKLALKSTLDIIAEF
HNRGDGSGCDCEIMLITDGAPDSYQYIFDQAHNLSISQSHFRVFAYLVGQDKNYLEPVKD
MACNNNGFFTQVKSPTGVTEQVLHHVNVMNRPLAYQGDHHVTWTKAYYDTTNGDEGFGLI
STVASTVYKMVPGEPTAFLGIMATDVPISDMMNSMPINRIGVNAYVYMVTNNAYVMFHPW
LETKYVGWDGKVKTKLDYNSIDIDKLEKDDGHAEIRSALVNRRTGQVSTKQHYTPLDNDM
KSLLISSGVYYFVPVADTPFSLAMFLPSKYGHTKVNYSANLRSIRYDAIIDEVHCNEVQK
QMRRNDWVEIDRIAAICSLRYSDVSVAETWRYCWFKNKQSIEEMGWLSQIDMLKRYLLSP
NSQTIKCNQELVNGVLFDVYLTATLQSVWSEQKMHQNTSGKGIEMTFFISRSGVVRKYWH
TDAQDAYKEDRNVVFRFDKLEYPLIYRRAVTQPKDSWLYVVPPTTRGNNKQVVFAAKAVR
QKEAIMGVSGLMLGYESFASLFWDEVAQVYGVDCMDRTNKRFCYLVDDNAKIVLSKENQE
VGRFFGEINGHVMNQLIEAKVFDRIVLTDETAMCQVKQTKKNVGSAASNVRYNLPFFSVW
SYFMWWTKELVVLLANVALYNWWTLAVVSQPVQANIRNQPNYRPCNQKYEVFVANRSKTP
YTNRTWCKDNYAMLCEGEFGVFNVSNSNLFLIVTEQLWASDFERERCNCSGKSEPFSPIR
GLEVEAAMEDTCWRAKIIKERKRPLSCLQAKEGAPVKEQPCTTEVKPPTNSGAKLLPFWG
GIAAKSSKGLRTFYSAWISCLTIHMVVIAVFSVICDGSLLRSPVL
NT seq 3558 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgaaaacatggagtattcgcgtacaatattttctcgttacatttctctcttta
tcgctacacatgcaatggatctgcacgacttgctttgctgtatcacttggtgcacaggcg
agcaataacgagttggctcagagctttggtgccgccctcaacgtcaaggcaactttatac
agcgggtacgccgccatgcagagcacatacgaaaacaggctgaacgctggagtgtttact
gtacatcgacttaatggaactaagttgattaaaaccatggctgcagaccttgagaaaatg
ctaaacagaaaacgacttgctgtagaaagactcgtacaagtcgctgaacgacatgccgcg
aaatacgactgggataaagaaccatcagatgaatacaacaacattcaatacatcaatgca
cctgaaccgtccaacatagaagaagatgattatgccagtttaaggaaacaaatgcaattc
aagagcgacgctaggttcgaacgtgatgtcaacaagaatacttcaatagttcaagttcca
tttaacgtctatagtaaaggcaccaagctgttgaaatcagtcggttggtcaaaggcgtta
aaccagcaattcaaacgaaacttggaacttgaaccttcgttaaaatggcaatacttcggt
tcaactgaaggatatattcgtgtttaccctgggttccaatggcggatgagagctgggcct
catgaccaacttaacatatatgactgtagaacgaggttatggtacacgcagtcgtctacc
taccccaaagatatgatcatcctcttagataggagtggaagcatgaaaggtttaaagaaa
tcgatcgccatcgatgctgtgtctgctttactggatacacttggtgacaacgactttttc
aacgttttaacgtttagcaagaaggtaatccctgtggatccatgttacaactctacatta
atgcgagccgaccgtacaaataaagagaacgttctcacgcgtctacgggacatggagacc
tctgatattgccaactttaaactcgcactgaagagcacacttgatatcattgccgaattt
cacaacagaggagacggcagcggttgtgactgcgagataatgttgatcaccgatggagcg
ccagacagctaccaatatatatttgaccaggcccacaacttatctatttcccagagccat
ttccgagtcttcgcttatctggtcggacaggacaagaattatctcgaaccagttaaagat
atggcgtgtaataataacggcttcttcactcaagtaaaaagcccgactggtgtcacagaa
caagtcttgcatcacgttaacgtcatgaatcgacctctcgcgtatcagggcgaccaccac
gtgacgtggacaaaggcgtattatgacacaacaaatggggacgagggtttcggtttgata
agcactgttgcttccacagtctacaagatggtgcccggggaaccgactgcgttcctgggt
ataatggcaactgacgtgcccataagtgacatgatgaatagcatgcccataaacaggatt
ggcgtgaacgcttacgtatacatggtcaccaacaatgcctacgttatgtttcacccatgg
ttggaaacaaagtacgttggttgggatgggaaggttaaaactaagcttgattacaacagc
atagacattgacaagttggaaaaggatgacggacacgctgaaattaggtcagctttggta
aatagaagaactggacaagtttcaaccaagcaacattacacacctctggataacgacatg
aagtcactcctaatatcaagtggtgtgtattactttgtgcctgtggctgacactccattc
agtttagccatgtttctaccatctaagtatggccacaccaaagtcaactactcagctaac
ctacgatctataagatatgatgctatcattgatgaggtgcattgtaatgaggtgcagaaa
caaatgcgaagaaatgactgggttgagattgatcgtatcgctgctatatgttcattaagg
tatagcgacgttagtgttgctgaaacttggagatattgctggtttaagaacaaacaaagc
attgaagaaatgggatggttgtcgcaaatagacatgctgaagcgatatctcctctctccg
aatagccagaccataaaatgtaaccaggagttggtgaatggagtattgtttgatgtttat
cttacagcgacacttcagtctgtttggtcagaacaaaaaatgcatcaaaatacttcaggc
aaaggcattgagatgaccttctttatctcccgaagtggtgtagtgagaaagtattggcac
acagatgcacaagatgcttataaggaagataggaatgttgtatttagatttgataaattg
gaatacccgttaatatacagacgagctgtaactcaacctaaagatagttggttgtatgtt
gtaccccctaccacacgtggtaacaataaacaagttgtgtttgctgcaaaagctgtgaga
caaaaagaagcaattatgggagtgtcgggtttgatgctcggatacgaaagttttgcttct
ttgttctgggatgaagtggcgcaagtgtatggggtggactgtatggataggacgaacaaa
aggttttgttacctcgtggatgacaatgcaaagattgttctttccaaggagaatcaagaa
gttggtcgtttctttggcgaaataaacgggcacgtaatgaaccaattaatcgaggcgaaa
gttttcgaccgtatcgtgttaaccgatgagacagcaatgtgtcaagttaaacagacaaag
aaaaatgtgggctcggccgcttctaatgttcggtataacttgccattcttctcagtatgg
tcttactttatgtggtggacgaaggaactggttgttctcctagcaaatgttgctttatac
aactggtggacattagctgtggtatcccagcctgtgcaagcaaatatcaggaaccaacca
aactacagaccttgcaatcaaaagtacgaagtgtttgtggccaatagatcaaagacaccg
tacacaaatagaacttggtgtaaagataattatgcaatgctgtgtgaaggtgagttcgga
gtgttcaacgtaagcaacagcaatctgttcctgatcgttacggagcaactatgggcaagt
gactttgagagagaaagatgtaattgctctgggaagagcgagccattctctcccatcaga
ggacttgaggtggaagcagcgatggaagacacttgttggagagcaaagataataaaggag
aggaagagacctttgtcatgtttacaagctaaagaaggggcacctgtaaaggagcaacca
tgtacaactgaggttaagcctccaactaattctggagcaaaactccttccgttttggggt
ggcattgcagcaaagtcaagtaaaggcttaaggacgttttactcagcatggatttcatgc
ttgactatacatatggtcgtgattgcagtattttctgtgatatgtgatggatcattactt
aggtctcctgttttatga

DBGET integrated database retrieval system