KEGG   Ciona intestinalis (sea squirt): 100184178Help
Entry
100184178         CDS       T01056                                 

Definition
(RefSeq) voltage-dependent calcium channel subunit alpha-2/delta-3-like
  KO
K04860  
voltage-dependent calcium channel alpha-2/delta-3
Organism
cin  Ciona intestinalis (sea squirt)
Brite
Ion channels [BR:cin04040]
 Voltage-gated cation channels
  Ca2+ channel, CACN alpha-2 delta
   100184178
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 666 aa AA seqDB search
METSDIANFKLALKSTLDIIAEFHNRGDGSGCDCEIMLITDGAPDSYQYIFDQAHNLSIS
QSHFRVFAYLVGQDKNYLEPVKDMACNNNGFFTQVKSPTGVTEQVLHHVNVMNRPLAYQG
DHHVTWTKAYYDTTNGDEGFGLISTVASTVYKMVPGEPTAFLGIMATDVPISDMMNSMPI
NRIGVNAYVYMVTNNAYVMFHPWLETKYVGWDGKVKTKLDYNSIDIDKLEKDDGHAEIRS
ALVNRRTGQVSTKQHYTPLDNDMKSLLISSGVYYFVPVADTPFSLAMFLPSKYGHTKVNY
SANLRSIRYDAIIDEVHCNEVQKQMRRNDWVEIDRIAAICSLRYSDVSVAETWRYCWFKN
KQSIEEMGWLSQIDMLKRYLLSPNSQTIKCNQELVNGVLFDVYLTATLQSVWSEQKMHQN
TSGKGIEMTFFISRSGVVRKYWHTDAQDAYKEDRNVVFRFDKLEYPLIYRRAVTQPKDSW
LYVVPPTTRGNNKQVVFAAKAVRQKEAIMGVSGLMLGYESFASLFWDEVAQVYGVDCMDR
TNKRFCYLVDDNAKIVLSKENQEVGRFFGEINGHVMNQLIEAKVFDRIVLTDETAMCQVK
QTKKNVGSAASNVRYNLPFFSVWSYFMWWTKELVVLLANVALYNWWTLAVVSQPVQANIR
NQPNYR
NT seq 2001 nt NT seq  +upstreamnt  +downstreamnt
atggagacctctgatattgccaactttaaactcgcactgaagagcacacttgatatcatt
gccgaatttcacaacagaggagacggcagcggttgtgactgcgagataatgttgatcacc
gatggagcgccagacagctaccaatatatatttgaccaggcccacaacttatctatttcc
cagagccatttccgagtcttcgcttatctggtcggacaggacaagaattatctcgaacca
gttaaagatatggcgtgtaataataacggcttcttcactcaagtaaaaagcccgactggt
gtcacagaacaagtcttgcatcacgttaacgtcatgaatcgacctctcgcgtatcagggc
gaccaccacgtgacgtggacaaaggcgtattatgacacaacaaatggggacgagggtttc
ggtttgataagcactgttgcttccacagtctacaagatggtgcccggggaaccgactgcg
ttcctgggtataatggcaactgacgtgcccataagtgacatgatgaatagcatgcccata
aacaggattggcgtgaacgcttacgtatacatggtcaccaacaatgcctacgttatgttt
cacccatggttggaaacaaagtacgttggttgggatgggaaggttaaaactaagcttgat
tacaacagcatagacattgacaagttggaaaaggatgacggacacgctgaaattaggtca
gctttggtaaatagaagaactggacaagtttcaaccaagcaacattacacacctctggat
aacgacatgaagtcactcctaatatcaagtggtgtgtattactttgtgcctgtggctgac
actccattcagtttagccatgtttctaccatctaagtatggccacaccaaagtcaactac
tcagctaacctacgatctataagatatgatgctatcattgatgaggtgcattgtaatgag
gtgcagaaacaaatgcgaagaaatgactgggttgagattgatcgtatcgctgctatatgt
tcattaaggtatagcgacgttagtgttgctgaaacttggagatattgctggtttaagaac
aaacaaagcattgaagaaatgggatggttgtcgcaaatagacatgctgaagcgatatctc
ctctctccgaatagccagaccataaaatgtaaccaggagttggtgaatggagtattgttt
gatgtttatcttacagcgacacttcagtctgtttggtcagaacaaaaaatgcatcaaaat
acttcaggcaaaggcattgagatgaccttctttatctcccgaagtggtgtagtgagaaag
tattggcacacagatgcacaagatgcttataaggaagataggaatgttgtatttagattt
gataaattggaatacccgttaatatacagacgagctgtaactcaacctaaagatagttgg
ttgtatgttgtaccccctaccacacgtggtaacaataaacaagttgtgtttgctgcaaaa
gctgtgagacaaaaagaagcaattatgggagtgtcgggtttgatgctcggatacgaaagt
tttgcttctttgttctgggatgaagtggcgcaagtgtatggggtggactgtatggatagg
acgaacaaaaggttttgttacctcgtggatgacaatgcaaagattgttctttccaaggag
aatcaagaagttggtcgtttctttggcgaaataaacgggcacgtaatgaaccaattaatc
gaggcgaaagttttcgaccgtatcgtgttaaccgatgagacagcaatgtgtcaagttaaa
cagacaaagaaaaatgtgggctcggccgcttctaatgttcggtataacttgccattcttc
tcagtatggtcttactttatgtggtggacgaaggaactggttgttctcctagcaaatgtt
gctttatacaactggtggacattagctgtggtatcccagcctgtgcaagcaaatatcagg
aaccaaccaaactacaggtag

DBGET integrated database retrieval system