KEGG   Ciona intestinalis (sea squirt): 100184179Help
Entry
100184179         CDS       T01056                                 

Definition
protein disulfide-isomerase A4-like
Orthology
K09582  
protein disulfide-isomerase A4 [EC:5.3.4.1]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:cin00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    100184179
Enzymes [BR:cin01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     100184179
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
10
AA seq 628 aa AA seqDB search
MYRWKNILLLISLGLLLTASLSKADEEENDDSEDEEEESAPSEPERENGVYVLTDDNFDS
FIEDKEVVLLEFYAPWCGHCKTFAPTYEKIAQALEGKVAVAKIDATASKDLGGRYEVTGY
PTVKILKKVDGEHQAITYDGARTEDAVVQKVMELSDPDWKPPPEAVLTLTTENFDETVNN
ADIILVEFYAPWCGHCKKLAPEYEAAAQELKNRDTPLPLAKVDATAESALGTRFDVSGYP
TLKLFRRGRAYEYDGGRDKTGIVNYMLEQSKPPSTSVETVKAIRNILHHSSDVTIIGCFN
GADDTNLEVYQDSGNSLRSEYTFHHTFNKDVMDDVGCSEGEIVLFHPERFHSKYEKKSYK
FPFSKSTTKAELEKYFSSHSVPLVGQRTRDNKDKRYGKRPLVVVYYGVDFSFDYRVATQV
WRNKVLEVANQFKKVTFAIANEEDFQEELKRVGLEDSPEEINVIAYDDEDRKYPMEPNEE
FDAEVLQEFVEDFLAGKLKPKIKSAPKPKKNSGAVKVVVGDTFNELVMGKKNVLIEFYAP
WCGHCKKLEPVFKKLGKKLKGNDKVVIAKMDATANDIPHSAYKAEGFPTLYWAPEGSKDK
PVKYDGGRELDDLLKFVNEKLSSSKDEL
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atgtatcggtggaaaaacattttacttcttatatctcttggcttattgctgacagcaagt
ttaagcaaagctgatgaagaagagaatgatgattcagaagacgaggaagaagaatctgcg
ccctctgaaccagaacgggaaaatggggtttacgttttaactgatgataattttgattct
ttcatcgaagataaagaagttgttttattggagttttacgccccatggtgcggccactgc
aaaacatttgctcccacatatgaaaaaattgcacaggctttggagggaaaagttgcggtt
gcgaaaattgatgcaacagcaagtaaagatctaggagggaggtacgaagtcaccgggtat
ccaactgtaaagattctaaaaaaagttgatggagaacatcaagctatcacatatgatggc
gcaaggactgaagatgctgtcgtgcaaaaagtgatggagctatcggaccctgactggaag
ccaccaccagaggcagtattgacactcaccaccgaaaactttgacgagacggtgaacaac
gctgacattattctggttgagttttacgccccatggtgtggccactgcaagaagctcgcc
cccgaatacgaggcagctgctcaggagttaaagaatcgggatacgccgttacctcttgct
aaggttgatgcaacagcagaatctgccctaggaacgaggttcgatgtatcgggttacccc
acacttaagttgtttagacgcggacgcgcatatgaatatgacggtggtcgggataaaaca
ggcatcgtgaactacatgttggagcagagtaaaccaccttccacgagcgtagaaactgtg
aaagcgatccgaaacatacttcatcattcatctgatgttaccatcattggatgcttcaat
ggtgctgatgatactaacttggaagtttaccaagattctggcaacagccttcgatccgaa
tacactttccaccacacgttcaacaaagatgtgatggacgatgttggatgttcagaagga
gagatcgtcctgtttcatcccgagcgatttcattcaaaatatgagaagaaaagttacaag
tttcccttttctaaaagcacaacaaaagcagaactcgagaaatatttttcatctcactct
gtaccactggttggacaacgtacgagagataataaagacaagagatacggaaaacgtcct
ctcgtggttgtgtattatggtgtggactttagttttgattacagagtggcaactcaggtt
tggagaaacaaagtcttggaagtcgcaaatcaatttaaaaaagttactttcgcaatcgcc
aatgaagaagatttccaagaggaattaaagagagttggtttggaagattcacccgaagag
ataaacgtgatcgcttatgatgatgaagatagaaaatatcccatggaaccgaatgaggag
tttgatgcagaggttctacaagaatttgtcgaagatttcttagcaggcaaattgaaaccg
aaaattaaatctgctccaaaaccaaagaaaaacagtggagcagtgaaagttgtagttggt
gacacatttaatgaacttgtgatgggaaaaaagaacgtcctaatagaattctatgcacca
tggtgtggccattgtaaaaaacttgaaccagtgtttaaaaaactaggaaagaaattaaag
ggcaacgacaaagtagtaattgccaaaatggacgcaactgcaaacgacattcctcactct
gcgtataaagcagaaggttttcctacgttgtactgggcaccagagggctccaaagataaa
ccagtgaaatacgatggcggtagagagcttgacgatctcctgaaatttgttaacgagaaa
ctcagcagctctaaagacgaactttaa

DBGET integrated database retrieval system