KEGG   Ciona intestinalis (sea squirt): 100184309Help
Entry
100184309         CDS       T01056                                 

Gene name
pnpla6
Definition
patatin-like phospholipase domain-containing protein 7
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:cin00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    100184309 (pnpla6)
Enzymes [BR:cin01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     100184309 (pnpla6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 1373 aa AA seqDB search
MDYFGAVNNWLDLFNMSSSSSEESSMVVMWVGAIATLLLVFLTFAYFFKTKMQVPVISIP
EVESNKKYRFRKRDKVQFYARKVFRKGRDTASKLQKQVSMIKEGVSVPEYSRSGRRLDNR
ERMMILAKRMFSGKKGPSLLLKKELPSLLLEADQEEEQFPNLPEEVMYLLQSVKVFGHFE
KGVFLQLCRHMETINLAQGDYLFKVGEEDKWLYVVQEGQVNLFINEGNNEVKLSELCAGE
SCTVFSAYINFRLPANAFSEAFKNRKESLVQIVQVIMTRMQRVTFLALHNYLGLSQELLR
PTNRVSDDQLSIRKMSSSNILSELVERHSLSSADLKEQLAHKDDTPDAKHEEEVVSTTIL
PRSKSQPVVINNGGKVKQIRFNEIDTVVDDNDNVFHRQSSLPSDAKKQIDFKESVRQAQS
RSIDAFMTPSPSEASCSCDSSSDVKIFELNEPEVLDLVTADLCQVFGIDDREMLQEHIAL
LKVCKGHQLINEGDQEVSIYFVVTGNLRVSQTLPEVGFDEQRNVTLFEAKPGMLTGQLAV
LTGEPSFFEVSALVDSVIARVTRQSFYKMMRRYPRMVLNTAHTVMLRVSSFVRQIDFALD
WQMVEAGKALYKQGSRSDCMYIILHGRLRSVHLKSDGKKELVAEYGKGEIVGMTEALKGI
SRPTSLHAVRDTELAKIPEGLIKQIRRQHPGVVTRLISLMSDKILGNMLSQKKSHVRSSD
VLAPKQTMQEETSFAYGDVSNHLANLSTVAILPASSDVPLDKVSMELHHALGGICNQVLR
LNSDLIIQRLGHNALDSVQEYRLSNWLAHHEDSHRMVLYQTDFTMTPWTQRCIRQADAVL
IVALGDGEPKVGKLEAQLEGMAVRALKMLVLLHRPGIIRPTRTVDWLNMRGWLTEHIHIK
CPKRLFGRTRKSKMVEYWEKLSTKPVDKFSDFSRLARFLTGTSIALVLGGGGARGLSQIG
ILQSLQNAGVPVDMIGGTSIGAFMGGLWAAHRNIETMKEKSLILCDDMSSIVSKILDLTY
PFTSMFSGASFNRAIHTIFKDIQIEDLWIPYFTITTDITSSEMRVHTDGWLWRYVRASMS
LSGYLPPLCDPKDGHLLMDGGYLNNLPGDVARARGACKVIAVDVGSETEVDFTDYGDHLS
GWWLLWKRWTGRWTGRIKVPDLNDIQSRLSYISCHYLLEKVIKSDYCFYVRPPIAKYKTL
EFHKHKELYQVGFNHGVKIFTDEWASHFWKELISDQNLPVSQSIASKGRADISFTDLSEF
LTEQMETNDLRNPSDSEYEFGYDSSPETFFRGSNGMRRMMSEPYDMNKMTEIRSIDQKQD
TVQSLCAITSASPTTSHNYDRRHSSFQQTQTIIPSYSSDDEEDDSRLILSSSI
NT seq 4122 nt NT seq  +upstreamnt  +downstreamnt
atggattattttggggcagtcaataattggttggacttgtttaatatgtcgtcttcttca
agtgaagaaagcagcatggtggtgatgtgggttggagcaattgcaacattattgctcgtg
tttcttactttcgcttatttcttcaagaccaagatgcaagtgcctgttatatcaatacct
gaagtggaatcaaacaagaaatacaggttcaggaaaagggataaagtccagttttatgct
cgaaaagtatttcgcaagggtagagatacagcttccaagctacaaaagcaagtgtccatg
ataaaggaaggtgtcagtgtgccggagtattcaagatctggtcgaagacttgataacaga
gaaagaatgatgattttagcaaagcgaatgtttagtgggaaaaaaggtccatcgttactt
ctgaaaaaagaacttccttctttactcctggaagctgaccaggaggaagagcaatttcct
aatcttcccgaagaagtgatgtaccttctgcagagtgttaaagtgtttggtcacttcgag
aaaggtgttttccttcaactatgtcgtcatatggaaaccattaacctcgcacaaggggat
tacctttttaaagttggagaagaagataaatggctttatgtggtgcaggaaggacaagtc
aacttgtttatcaatgaaggaaataatgaggtaaaactgagtgagttatgtgcaggagaa
agttgcacagtcttctcagcatatatcaattttagacttccagcaaatgctttcagtgaa
gcatttaagaatcgaaaagaatctcttgttcaaattgtgcaagtcattatgacccgtatg
cagcgtgtcactttccttgccctgcataattatcttggtctttcacaagaattattgcga
ccaacaaacagagtatctgatgatcaactttcaataaggaaaatgtcgtcgtcaaatatt
ttgtctgaactcgtggaacgacacagtttgagttccgctgacttgaaagaacaacttgcc
cataaagatgatacacccgatgccaaacatgaagaagaagtcgtttccacaaccatatta
cctcgctccaagtcgcaacccgttgtgataaataatggtggaaaagtgaagcagattcga
ttcaatgagattgacacggttgttgatgataacgataatgtctttcatagacaatcgagt
ctaccatcagatgcaaaaaaacaaattgattttaaagaaagtgttcgtcaagctcaatct
agatcaatagatgcttttatgacaccatcaccaagtgaggcttcatgttcttgtgacagc
tcatctgatgtcaagatatttgaactgaatgaaccagaagtgttggatctggtaactgca
gatctgtgtcaagtgtttggtattgatgacagggaaatgttacaagaacatatcgcttta
cttaaagtatgtaagggccatcaattaattaatgaaggcgatcaagaagtttcaatctac
tttgttgtgaccggcaacttgagagtttcacaaacattacctgaagttggttttgatgaa
caaagaaatgtgactttgtttgaagcaaaaccaggaatgttaactggccaacttgcggtg
ctcacgggagaaccttcattcttcgaggtttctgctctcgttgattccgtaatagccaga
gtgactcggcaaagtttctacaaaatgatgcgtcgttacccccgcatggttcttaacacg
gcacacaccgtcatgctgagggttagttcgttcgttcgtcaaatcgacttcgctcttgat
tggcagatggtggaagctggaaaggcgttgtacaaacaaggcagtagaagtgactgcatg
tatataattcttcacggtcgcttgcgctcagtgcatttaaagtcagatggaaagaaggaa
ctggttgcggaatatggaaagggagagattgttggaatgactgaagcattaaaaggtata
tctcgtccaacatcgttacatgcagttcgcgatactgagttggctaaaatacctgaaggg
ctaattaaacagataaggaggcaacatcctggtgttgtgacgcgacttatttcactgatg
tccgataaaatacttggtaacatgctttcacaaaagaagtcacatgtaaggtcatcagat
gtacttgctcccaaacaaactatgcaagaagaaactagttttgcatatggagatgtttca
aaccatcttgccaacttatcaactgtcgctatattacccgcttcaagtgatgtgccgtta
gataaagtatctatggaattacatcatgcactggggggcatttgtaatcaggttttaaga
ctcaacagcgatctaattattcaacgtctcggtcataatgcacttgacagtgtgcaagaa
tacaggttatctaactggttggcccaccatgaggattcacatcgaatggttctttatcaa
actgactttaccatgacaccatggacacaacgttgtataagacaggctgatgctgtttta
atcgttgcacttggtgatggagaaccaaaagttgggaagttggaggcccagcttgaaggg
atggctgttcgggctttaaagatgttggttctgcttcaccgaccaggcattatacgacca
acgagaacagttgattggttaaacatgaggggatggttgactgaacatattcatattaaa
tgtccaaagcgattgttcggacgaacacgtaaatcaaaaatggtggagtactgggaaaag
ttgtcaacaaaaccagttgataaatttagtgatttttctcggcttgcacgatttcttact
ggaacatctatcgctcttgtgcttggtggtgggggcgctagaggtctttcacaaatcgga
attttgcaatcacttcaaaacgctggtgttcccgttgatatgattggtggtacttccatc
ggtgcctttatgggcggactgtgggcagctcatcgtaacattgaaacaatgaaagaaaag
tcgctgatactttgtgatgatatgagttcaattgtatcaaaaatactcgacctaacgtat
ccgtttacatccatgttctctggtgcttcattcaatcgagcaatccacacaatatttaaa
gatatacagatcgaggatctatggattccatatttcaccatcacaaccgatatcacttca
tctgagatgcgggtgcataccgacggttggttatggaggtatgtgcgtgcaagcatgtca
ttatcaggatatctgcctccactttgtgacccaaaagatggccacttgctaatggacgga
ggatatctcaataacttaccaggtgatgttgcgagagcacgtggtgcatgtaaggttatt
gccgtcgatgttggatctgaaactgaagtcgatttcactgattatggcgaccatttatct
ggatggtggttgctatggaaacggtggacaggaaggtggacgggcaggatcaaggttcct
gacttaaatgacatacagtcgcgactgtcgtatatatcttgtcactatctgcttgaaaaa
gtcattaaatctgattattgtttctacgtacgacctccaattgcaaaatataaaacgctg
gagttccacaagcataaggaactgtaccaggttggcttcaatcacggtgtgaaaatattc
actgatgaatgggcgtcgcatttctggaaggaattgatcagtgaccagaacttacccgtg
agccaatctatcgcatcaaaaggtcgtgcagatatttcattcacagatctgtctgagttt
ttaaccgaacaaatggaaacgaatgatttaaggaatccatcagattcggaatacgaattt
ggatatgattcttcacctgaaactttcttccgtgggtcgaatggaatgcgaagaatgatg
agcgaaccatatgatatgaataaaatgaccgaaattcgctctattgaccaaaagcaggac
actgtacaatcgctttgtgccatcacatctgcaagtccgacaacgtcacataattatgat
agacgacattcttcttttcaacaaacacaaaccattattccttcttattcatcagatgat
gaagaagatgattcgaggttaattctctcatcttctatatga

DBGET integrated database retrieval system