KEGG   Ciona intestinalis (sea squirt): 100184309Help
Entry
100184309         CDS       T01056                                 

Gene name
pnpla6
Definition
patatin-like phospholipase domain containing 6
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:cin00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 1094 aa AA seqDB search
MTRMQRVTFLALHNYLGLSQELLRPTNRVSDDQLSIRKMSSSNILSELVERHSLSSADLK
EQLAHKDDTPDAKHEEEVVSTTILPRSKSQPVVINNGGKVKQIRFNEIDTVVDDNDNVFH
RQSSLPSDAKKQIDFKESVRQAQSRSIDAFMTPSPSEASCSCDSSSDVKIFELNEPEVLD
LVTADLCQVFGIDDREMLQEHIALLKVCKGHQLINEGDQEVSIYFVVTGNLRVSQTLPEV
GFDEQRNVTLFEAKPGMLTGQLAVLTGEPSFFEVSALVDSVIARVTRQSFYKMMRRYPRM
VLNTAHTVMLRVSSFVRQIDFALDWQMVEAGKALYKQGSRSDCMYIILHGRLRSVHLKSD
GKKELVAEYGKGEIVGMTEALKGISRPTSLHAVRDTELAKIPEGLIKQIRRQHPGVVTRL
ISLMSDKILGNMLSQKKSHVRSSDVLAPKQTMQEETSFAYGDVSNHLANLSTVAILPASS
DVPLDKVSMELHHALGGICNQVLRLNSDLIIQRLGHNALDSVQEYRLSNWLAHHEDSHRM
VLYQTDFTMTPWTQRCIRQADAVLIVALGDGEPKVGKLEAQLEGMAVRALKMLVLLHRPG
IIRPTRTVDWLNMRGWLTEHIHIKCPKRLFGRTRKSKMVEYWEKLSTKPVDKFSDFSRLA
RFLTGTSIALVLGGGGARGLSQIGILQSLQNAGVPVDMIGGTSIGAFMGGLWAAHRNIET
MKEKSLILCDDMSSIVSKILDLTYPFTSMFSGASFNRAIHTIFKDIQIEDLWIPYFTITT
DITSSEMRVHTDGWLWRYVRASMSLSGYLPPLCDPKDGHLLMDGGYLNNLPGDVARARGA
CKVIAVDVGSETEVDFTDYGDHLSGWWLLWKRWTGRWTGRIKVPDLNDIQSRLSYISCHY
LLEKVIKSDYCFYVRPPIAKYKTLEFHKHKELYQVGFNHGVKIFTDEWASHFWKELISDQ
NLPVSQSIASKGRADISFTDLSEFLTEQMETNDLRNPSDSEYEFGYDSSPETFFRGSNGM
RRMMSEPYDMNKMTEIRSIDQKQDTVQSLCAITSASPTTSHNYDRRHSSFQQTQTIIPSY
SSDDEEDDSSLLFF
NT seq 3285 nt NT seq  +upstreamnt  +downstreamnt
atgacccgtatgcagcgtgtcactttccttgccctgcataattatcttggtctttcacaa
gaattattgcgaccaacaaacagagtatctgatgatcaactttcaataaggaaaatgtcg
tcgtcaaatattttgtctgaactcgtggaacgacacagtttgagttccgctgacttgaaa
gaacaacttgcccataaagatgatacacccgatgccaaacatgaagaagaagtcgtttcc
acaaccatattacctcgctccaagtcgcaacccgttgtgataaataatggtggaaaagtg
aagcagattcgattcaatgagattgacacggttgttgatgataacgataatgtctttcat
agacaatcgagtctaccatcagatgcaaaaaaacaaattgattttaaagaaagtgttcgt
caagctcaatctagatcaatagatgcttttatgacaccatcaccaagtgaggcttcatgt
tcttgtgacagctcatctgatgtcaagatatttgaactgaatgaaccagaagtgttggat
ctggtaactgcagatctgtgtcaagtgtttggtattgatgacagggaaatgttacaagaa
catatcgctttacttaaagtatgtaagggccatcaattaattaatgaaggcgatcaagaa
gtttcaatctactttgttgtgaccggcaacttgagagtttcacaaacattacctgaagtt
ggttttgatgaacaaagaaatgtgactttgtttgaagcaaaaccaggaatgttaactggc
caacttgcggtgctcacgggagaaccttcattcttcgaggtttctgctctcgttgattcc
gtaatagccagagtgactcggcaaagtttctacaaaatgatgcgtcgttacccccgcatg
gttcttaacacggcacacaccgtcatgctgagggttagttcgttcgttcgtcaaatcgac
ttcgctcttgattggcagatggtggaagctggaaaggcgttgtacaaacaaggcagtaga
agtgactgcatgtatataattcttcacggtcgcttgcgctcagtgcatttaaagtcagat
ggaaagaaggaactggttgcggaatatggaaagggagagattgttggaatgactgaagca
ttaaaaggtatatctcgtccaacatcgttacatgcagttcgcgatactgagttggctaaa
atacctgaagggctaattaaacagataaggaggcaacatcctggtgttgtgacgcgactt
atttcactgatgtccgataaaatacttggtaacatgctttcacaaaagaagtcacatgta
aggtcatcagatgtacttgctcccaaacaaactatgcaagaagaaactagttttgcatat
ggagatgtttcaaaccatcttgccaacttatcaactgtcgctatattacccgcttcaagt
gatgtgccgttagataaagtatctatggaattacatcatgcactggggggcatttgtaat
caggttttaagactcaacagcgatctaattattcaacgtctcggtcataatgcacttgac
agtgtgcaagaatacaggttatctaactggttggcccaccatgaggattcacatcgaatg
gttctttatcaaactgactttaccatgacaccatggacacaacgttgtataagacaggct
gatgctgttttaatcgttgcacttggtgatggagaaccaaaagttgggaagttggaggcc
cagcttgaagggatggctgttcgggctttaaagatgttggttctgcttcaccgaccaggc
attatacgaccaacgagaacagttgattggttaaacatgaggggatggttgactgaacat
attcatattaaatgtccaaagcgattgttcggacgaacacgtaaatcaaaaatggtggag
tactgggaaaagttgtcaacaaaaccagttgataaatttagtgatttttctcggcttgca
cgatttcttactggaacatctatcgctcttgtgcttggtggtgggggcgctagaggtctt
tcacaaatcggaattttgcaatcacttcaaaacgctggtgttcccgttgatatgattggt
ggtacttccatcggtgcctttatgggcggactgtgggcagctcatcgtaacattgaaaca
atgaaagaaaagtcgctgatactttgtgatgatatgagttcaattgtatcaaaaatactc
gacctaacgtatccgtttacatccatgttctctggtgcttcattcaatcgagcaatccac
acaatatttaaagatatacagatcgaggatctatggattccatatttcaccatcacaacc
gatatcacttcatctgagatgcgggtgcataccgacggttggttatggaggtatgtgcgt
gcaagcatgtcattatcaggatatctgcctccactttgtgacccaaaagatggccacttg
ctaatggacggaggatatctcaataacttaccaggtgatgttgcgagagcacgtggtgca
tgtaaggttattgccgtcgatgttggatctgaaactgaagtcgatttcactgattatggc
gaccatttatctggatggtggttgctatggaaacggtggacaggaaggtggacgggcagg
atcaaggttcctgacttaaatgacatacagtcgcgactgtcgtatatatcttgtcactat
ctgcttgaaaaagtcattaaatctgattattgtttctacgtacgacctccaattgcaaaa
tataaaacgctggagttccacaagcataaggaactgtaccaggttggcttcaatcacggt
gtgaaaatattcactgatgaatgggcgtcgcatttctggaaggaattgatcagtgaccag
aacttacccgtgagccaatctatcgcatcaaaaggtcgtgcagatatttcattcacagat
ctgtctgagtttttaaccgaacaaatggaaacgaatgatttaaggaatccatcagattcg
gaatacgaatttggatatgattcttcacctgaaactttcttccgtgggtcgaatggaatg
cgaagaatgatgagcgaaccatatgatatgaataaaatgaccgaaattcgctctattgac
caaaagcaggacactgtacaatcgctttgtgccatcacatctgcaagtccgacaacgtca
cataattatgatagacgacattcttcttttcaacaaacacaaaccattattccttcttat
tcatcagatgatgaagaagatgattcgagccttctcttcttttga

DBGET integrated database retrieval system