KEGG   Ciona intestinalis (sea squirt): 100184338Help
Entry
100184338         CDS       T01056                                 

Definition
(RefSeq) alpha-2A adrenergic receptor
  KO
K04139  
adrenergic receptor alpha-2B
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:cin00001]
 Environmental Information Processing
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    100184338
G protein-coupled receptors [BR:cin04030]
 Class A. Rhodopsin family
  Biogenic amine [Fig]
   Adrenaline [OT]
    100184338
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
Position
7
AA seq 540 aa AA seqDB search
MEKALASRTEAINATMADHLVNIERDCLGNLNISSILYSEEQVVIFSALTSILCIIGLFG
NLTVIVVIRRDRVIYKHRQNLYLLSLAVADVSLVVLVVPFSITNELLGYWPFGTVYCRIY
LSVDILLCTASIWNICMIGLDRYISVKYPMTYRKFRTMPKIRLFIVSIWLFAAVVSLLPF
VSEIETINSERGCFINASSWYIVVSCSLSFFIPSCIIWPVYIRIYMIGRDLEISKRARHS
SNLGVVIDPRRQSNGNHIQMNMLIRRSDPKQDSTSKFETKVRRLSRTSRSLENLMTLLVV
PNSTNNSRSVTSATTDQRQMNRSQSFTECLNSGREDGNLLSSVAYDVTSQKIRLKSISSC
GGIINSKPDGAVTKESTVYVRNPPDPVFCCCLCSQTEDKSNLIFFRPLKKESINGDVTKS
NFVKRLQSLSSVTTLYNRRSSSQSQQSSCTTAMSRRERRFVCIISIITGCFMACWMPFFL
TYMIYAVCRACCINNTLFKVFFWLGYLNSALNPVLYTAFNKDFRSAFQRLFHLSGRRTIC
NT seq 1623 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaggctctcgcaagtcgtaccgaggcaattaacgcaacgatggctgatcacctt
gtgaacattgaacgtgattgccttggaaacttaaacatttcatctattttatattcggaa
gaacaagttgttattttctctgccctgacgtccattctctgcattattggccttttcggc
aatttaacggtgatcgttgttatacgtcgagatcgcgttatttacaaacatcgacaaaat
ctttacttactttcgcttgctgtggctgatgtctctctggtcgtccttgttgtgccgttt
tcaatcaccaatgaacttcttggttattggccgtttggtactgtgtactgtcgtatatat
ctgtcagttgacattctactatgtactgcttcaatatggaacatctgcatgataggactt
gaccgatatatatcagtgaaatatccgatgacctacagaaagttccgcactatgccgaag
ataagattgtttatcgtaagcatctggttatttgcagctgtcgtgtcccttctaccattt
gtctcggagatcgaaaccatcaatagcgaacgtggttgtttcatcaatgcttcatcatgg
tacatcgtggtttcttgttcactttccttttttataccaagctgcattatctggccagtg
tacatcaggatttacatgatcgggagagacttggagatttcgaaacgcgcgaggcacagc
tctaatctcggtgtggtcattgatccacgacgccaatcaaacgggaaccatattcaaatg
aacatgctgattcgacgaagcgatccaaagcaagactcaacaagcaagtttgaaaccaaa
gttcgaagattgtcacgaacatcaagaagtttggaaaacttgatgacgttgcttgttgtg
ccgaatagtaccaacaacagtagatctgtcacatcagctacaactgatcaacgtcaaatg
aatcgttcacaaagttttaccgagtgtttgaactctggccgggaagatggtaaccttctt
tcttccgttgcatatgacgtcaccagtcagaaaatccgacttaagtcaataagttcgtgc
ggaggtataatcaacagtaagccggatggtgctgtgacgaaagagtcgacggtttacgtc
agaaatccacccgatccggtgttttgttgctgcctttgtagccaaaccgaagataaaagt
aatctaattttttttcggccacttaagaaagaatctatcaacggtgacgtcacaaaatca
aactttgtgaaacgccttcaaagtttatcatccgtgaccactttgtataacagaaggagc
agttcacaatctcagcagagctcatgtaccacggcaatgtcacgacgtgaaagacgattc
gtgtgcatcatcagtattatcacgggttgcttcatggcgtgttggatgcctttctttctg
acgtacatgatttatgctgtgtgtcgggcgtgctgcatcaacaacactttgttcaaagtc
tttttctggctcggctacctcaatagtgcactcaaccctgtattatatactgcttttaac
aaagattttcggtcagcatttcagcggcttttccacttaagcggcaggcgaactatctgc
taa

DBGET integrated database retrieval system