KEGG   Ciona intestinalis (sea squirt): 100184470Help
Entry
100184470         CDS       T01056                                 

Definition
deoxycytidine kinase-like
Orthology
K00893  
deoxycitidine kinase [EC:2.7.1.74]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:cin00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:cin00240]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
14
AA seq 312 aa AA seqDB search
MRFRAFLTRVKHSHRDYSFCTLSNCSKVRLKMDSVQTVRRGKKFAIEGNIATGKSTFLKL
LESQSPDWSVVAEPVARWTNVSQDGDEVELTTSQKSGGNLLQMFYDDIHRWSYTFQSYAL
LSRMRLQREPLPASFTNEQVKKHVQFFERSMQSDRYIFALNCYESGCMSETEWNIYQDWS
QYLVHSIGELKLDGIIYLRANPEVCYQRMLKRGRPEESGVTMEYLECLNEKHESWLYRKD
VKMDESLSDVPVLVIDCNEEFVTNPEKHQSMMSMVHKFVGNPSTSLDDSGVDSQCSSISM
DSDEMDNSDIEY
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgagatttcgcgccttcttaacgagagtgaagcattcgcacagggattattcattttgc
acgctaagcaattgctcaaaagtacgtttaaagatggattctgttcaaaccgtacgaagg
ggaaagaaatttgcgattgaagggaacatagcaacgggaaaatcaacatttctaaagctt
ctggaatctcaatcgccggattggagcgtggtggcagaacctgtggcccggtggacgaac
gtaagtcaggatggtgacgaagttgaactgacgacttctcaaaaaagcgggggtaacctt
ttacaaatgttttacgatgatattcaccgttggtcgtatacttttcagtcctatgccctt
ctaagtcgcatgcgcttacaacgtgagccattgcctgccagctttactaacgaacaagtt
aaaaaacatgttcaattctttgaacgttcaatgcaatcagacaggtatatttttgcattg
aattgctatgaaagtggctgcatgtctgaaactgagtggaatatatatcaagattggtct
caatacttggtacatagcattggggagcttaaattggatggtataatttatcttcgtgct
aaccccgaggtttgctaccaacgaatgctgaaacgtggtcggccagaagaatcgggggtc
acaatggagtatctggagtgcttgaatgaaaagcacgaatcctggctttatagaaaagat
gtaaaaatggatgaatctcttagtgatgttcctgtattggtgattgactgcaatgaagaa
tttgttaccaacccagaaaagcatcagagcatgatgtcaatggttcataagtttgtgggg
aatccatctacttcattggatgattctggtgtcgattcacaatgtagctcaatctcaatg
gatagtgatgagatggacaattcagacattgaatattga

DBGET integrated database retrieval system