KEGG   Ciona intestinalis (sea squirt): 100184517Help
Entry
100184517         CDS       T01056                                 

Definition
histone acetyltransferase type B catalytic subunit-like
Orthology
K11303  
histone acetyltransferase 1 [EC:2.3.1.48]
Organism
cin  Ciona intestinalis (sea squirt)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 399 aa AA seqDB search
MEDIQNKLMPYICDANSAVQFKLVKSKEDLETDDGFFFPDMSHQIFGEKEQIFGFTDLKL
RIYYTASSLQIHTKLLYGRKINPEQFDGVKADDIMKSVREVLPANVIENVDDFSKKLDGE
PNFKPFGEIIYNYTRQQKGKSTKRNFEIYKADMTNPNFKEYHQRIESFILWFIDAACFID
SDDDKWDFYVVFEKCTEGGITSHLFVGYSTCYRFYAYPDKIRPRISQVLVLPPYQRQGHC
TELITAIYQQYVPKAAVLDITAEDPSENFQRVRDFIDSKNCLKLPEFQDSKLGQKFSKEM
RKAAQEKYKINRRQARRVYEILRLRITPENDDVAFTKYRLAVKSRLNEPMRNESLRKKSH
LLPASLVPPKEERLLMLQREFETCLHEYKKVITRLDISA
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atggaagacatacagaacaaattaatgccctacatttgtgatgctaacagtgcagttcaa
tttaagcttgttaaaagtaaagaggatttagaaacagatgatggatttttcttccctgat
atgtcgcaccaaatatttggtgaaaaagaacaaattttcggattcacagatttaaaattg
cgaatatattacacagcgagctcattacagattcatacaaagctgttatatggaagaaag
attaacccagaacagtttgatggagtcaaagcagatgatattatgaaaagtgtgcgcgaa
gtcttaccagccaacgttattgagaatgtggatgatttttcaaaaaaactcgatggggaa
ccaaattttaaaccgttcggagaaataatttacaattacactcgacagcaaaaaggaaaa
tcaacaaaacgaaacttcgaaatttacaaggcagacatgacaaacccaaatttcaaggaa
tatcatcaacgaatagaaagttttattctctggtttattgacgctgcgtgttttattgat
tccgacgatgataaatgggatttctacgttgtatttgaaaagtgcacagaaggagggata
acctcgcatttatttgttggatattcaacttgttacagattctatgcttaccctgacaaa
atacgaccacgaataagccaagtactggttcttccaccataccaaaggcaaggtcactgc
actgagttaatcacggccatctatcaacaatatgttcctaaggcagctgtgttagatata
acagctgaagacccgtcagaaaattttcaacgtgttcgtgattttatcgattcaaagaat
tgtttaaaattaccagagtttcaggattcaaagctgggccaaaagttctcaaaagaaatg
cgaaaagcagctcaagaaaaatataaaattaacaggcgccaagcacgcagagtttatgaa
atactacgactccgcataacaccagagaatgatgacgtagcattcacaaaatatcggctt
gcagttaaatcacgactcaacgaaccaatgaggaatgagtctctgcgaaaaaaaagtcat
cttttgccagcatcacttgttcctcctaaagaagagcgacttctgatgttgcaacgagag
tttgagacttgcctccacgaatataaaaaagttattacccggctcgatatctcagcgtaa

DBGET integrated database retrieval system