KEGG   Ciona intestinalis (sea squirt): 100184767Help
Entry
100184767         CDS       T01056                                 

Gene name
aldh1l2
Definition
cytosolic 10-formyltetrahydrofolate dehydrogenase-like
Orthology
K00289  
formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
One carbon pool by folate
Brite
KEGG Orthology (KO) [BR:cin00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    100184767 (aldh1l2)
Enzymes [BR:cin01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.6  formyltetrahydrofolate dehydrogenase
     100184767 (aldh1l2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
8
AA seq 898 aa AA seqDB search
MKIAVIGQSMFGADTYNILRKNGHKVVGVFTIPDVGGKQDPLAVAASQDGVPVFKFKRWR
LKGKPIPEVVEQYASCGAELNVMPFCSQFIPMNVIDHPKNGSIIYHPSILPKHRGASAIN
WTLMSGDKKAGFTIFWADDGLDTGPILLQRECDVKANDTVDDIYNRFLYPEGIKAMGEAV
QLIADGKAPKIVQSEEGASYEGIMKHSTAEINWDQPAINLHNFIRGNDKVPGAWTVINDE
KVTLFGSTVHRSKLPTGEAVQVKGMAQPGIVHKNGLLLYGSDGKKINVKNIQYSDGKMVA
ASKFGQADASETLELTEEEKGMMAKISTAWGGILNKEIDEETDFFKSGAGSMDVVRLVEE
VKQGIAVVLKNEDVYMNTTFGAFIQKVIRVFRGLEVEEELDVDYAEKEVKGNVLQMPHQL
FINNEFVDAANGDEYNTINPADESVICKVSKATVEDVDEAVEAAKEAFEVGPWSTMNPRD
RGEMMFKLANLMEEHQEELAMIESIDSGAVYTLALKTHVGMSIQTFRYFAGWCDKIHGKT
IPINQAHPNRNLTYTKREPIGVCAIVIPWNYPLMMLAWKMASCLAAGNTMVLKPAQVTPL
TALKFAELVVKAGFPKGVINILPGAGSNIGQRLADHPDIRKLGFTGSTPIGKQIMKSAAV
SNLKKVSLELGGKSPLIIFSDCDMDKAVRFGMSSVFFNKGENCIAAGRLFVEDSIHDEFV
ARIIEEIKKMKIGDPLSASTDHGPQNHKAHLDKLVEYCDVAVKEGATLTYGGKQCDMPGL
YMMPTVITDVQDHMYVAKEESFGPIMVVSKFPDGDVDGVLKRANDTEYGLASGVFTKDIS
KALYVSDKLDAGTVFVNTYNKTDVASPFGGFKQSGFGKDLGEDALNEYLKTKAVTLEY
NT seq 2697 nt NT seq  +upstreamnt  +downstreamnt
atgaagattgcagtcataggtcaatccatgtttggtgcagatacttataacattctgcga
aaaaatggccacaaagttgttggagtgtttactataccagatgttggtgggaagcaggat
cccctagctgttgctgctagccaagatggagtcccagtctttaaatttaaacgttggcga
ttaaagggcaaaccaatacctgaagtagtggaacaatatgcttcatgtggagctgaattg
aatgtgatgccattctgctcacaattcatacccatgaatgtgattgatcacccaaagaat
ggttccattatctaccatccttccatactaccaaagcatagaggtgcttctgccattaac
tggacccttatgtctggggacaagaaagctggctttacaatattctgggccgatgatggt
cttgatactgggcccatcttacttcaacgagaatgtgatgttaaagcaaacgataccgtt
gatgacatatacaacagatttctctaccctgagggtataaaggccatgggagaagctgta
caactgatagctgatggcaaggcaccaaaaattgtgcagtctgaagaaggggcttcatat
gaaggcattatgaaacacagcactgcagaaattaactgggaccaaccggcaatcaacttg
cataattttatcaggggcaatgacaaagttcctggggcttggacagttataaatgatgag
aaagtaactttgtttgggtcaactgtccatcgaagcaaactaccaactggggaggctgtt
caagtaaaaggaatggcacaaccaggcatcgtgcataagaacggacttcttctttatgga
agtgatggaaaaaagataaatgtgaaaaacatccaatactctgatggtaagatggttgct
gcttcaaaattcgggcaagcagatgcatctgaaacactggagcttactgaagaagaaaaa
ggaatgatggccaagatttctacagcttggggtggcatccttaacaaagagattgatgag
gaaacagacttctttaaatctggtgctggttctatggatgttgttaggttggtagaagag
gttaagcaaggtattgctgttgtcttaaaaaacgaggatgtatatatgaacaccacattc
ggtgcctttatacagaaggtgattcgagttttccgaggtttagaagttgaagaagagctt
gatgttgattatgccgaaaaggaggtgaaaggaaacgtgttgcagatgccacatcaactc
tttatcaacaatgaatttgttgatgctgcaaatggtgatgaatacaacaccatcaaccct
gctgatgaatctgtgatctgcaaagtatcgaaagcaacggtagaagatgtggatgaggca
gtggaggctgctaaggaggctttcgaggttggaccatggtccactatgaatcctagggat
cgtggtgaaatgatgttcaaactcgcaaacttaatggaagaacaccaagaagagcttgca
atgattgaatccattgattctggagcggtgtatacccttgctcttaaaacacacgtggga
atgtctatacaaacattcaggtactttgctggctggtgtgacaaaatccatggcaagaca
atcccaattaaccaggctcatccaaaccgtaacctcacctacaccaaacgagaacctatt
ggcgtgtgtgcgatagttattccatggaactacccactaatgatgttggcatggaagatg
gcgtcttgcttggcagctgggaacacaatggtgttgaaacctgcacaagttacccctctt
actgcactcaagtttgctgagctggtagttaaagccggctttcctaaaggagtaatcaac
attctgcctggagctggttcaaatattggtcagagactggcagaccatccagatatcagg
aaacttggttttactggatcaactccaattggaaagcagatcatgaaaagtgccgctgtc
agcaacctgaagaaagtatctctggagcttggtgggaaatcccctcttataatattcagt
gactgtgacatggacaaagcagttagatttggaatgagttctgtgtttttcaacaaagga
gaaaattgtatcgcagctggtcgtcttttcgttgaagattcaatccatgatgagtttgtt
gccaggatcattgaagagataaaaaagatgaagattggtgatcctttaagtgcaagcact
gatcatggaccacaaaaccacaaggctcacttagataaattggttgaatactgtgatgtt
gctgtgaaagaaggcgctacacttacatacggtggcaaacaatgtgacatgccaggcttg
tatatgatgccaactgttatcactgatgtacaagaccacatgtatgtagcaaaggaggaa
tcatttggacctatcatggtggtatccaagttccctgatggtgatgtagatggtgttttg
aagcgtgccaatgacactgagtatgggcttgcatctggagtgttcacgaaagacatcagc
aaagcattatacgtttctgacaagcttgatgctggtacagtatttgtaaacacgtacaac
aaaacagacgttgcttctccattcggtggttttaaacagtccggtttcggcaaagatctt
ggggaggacgcacttaacgagtatttgaagactaaagcagtaaccctggaatattaa

  All links  
No link information was found.   
DBGET integrated database retrieval system