KEGG   Ciona intestinalis (sea squirt): 100184786Help
Entry
100184786         CDS       T01056                                 

Gene name
gbe1
Definition
glucan (1,4-alpha-), branching enzyme 1
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:cin00500]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
11
AA seq 692 aa AA seqDB search
MDSGDGLKSSSNMVVPDLQTFLEIDPYIENFTGDIKRRYEMFSKTKARIEAAETMEKFSQ
SYKNFGVKGKPDGSVHCKEWVPGAKAVYLRGAFNNWERWGYSYEKKEFGKWELVLPPKDD
GSSMIEHLSELMLIIQTHDDQYLERISPWATYVKQFDNHGTYKWIFWNPPQSELYHFKNQ
RPKKPKSLRIYEAHVGIASSEPKVASYKNFTDTVLPRIKKLGYNCVQLMAIMEHAYYASF
GYQVTNFFAASSRYGTPTELQELIDTAHGMGLYVLLDVVHSHACKNVLDGLNMFNGTDSC
FFHSGSRGVHSQWDSRLFNYSEWEVLRFLISNLRWYMEEYKFDGFRFDGVTSMIYHDHAI
SRGFSGDYHEYFGLQMDMESLVYLILANDMIKTFLPDAITIAEDVSGMPGMCRPVSEGGI
GFDYRLAMAIPDQWIKILKEARDEDWDMDHIFHTLTNRRHGELCIAYAESHDQALVGDKS
LAFWLMDKEMYTHMSECTHLTPIIDRGISLHKMIRLITHGLGGEGYLNFIGNEFGHPEWL
DFPRAGNSSSYHYARRQFHLVDDNLLRYKFLYKFDSAMQNTEETYGWLAAKQAYVSRKHN
GDKVFVFERAGVLFLFNFHHSQSFTGYRVGVQNPGKYKIVLDSDDSEYGGHNRNDKSVRF
FTEEMAFDGREHSMLVYLPCRSAMIMAKDDTD
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atggattctggagatggtttaaaatcaagttcgaatatggtggtccctgatcttcaaact
ttcttggagattgatccctatattgaaaacttcactggagacattaaacggaggtatgag
atgttttcgaagaccaaggccaggattgaagctgcagaaacaatggaaaaattttcacaa
tcttataaaaattttggtgtgaaaggaaaacctgatgggtcagtgcattgtaaggaatgg
gtacctggggcaaaggcagtttatctgcgtggagcttttaataattgggagcgatggggg
tacagttacgagaaaaaagagtttggtaaatgggaattagtgttaccaccaaaagatgat
gggagttctatgattgaacatcttagtgaactcatgcttattatacaaacgcatgatgat
caatatcttgaaagaatttccccttgggctacttatgtcaagcagtttgacaaccatggg
acatataagtggatattttggaatccccctcaaagcgaattgtatcactttaaaaaccaa
cgccccaaaaaaccaaagagtttaagaatttatgaagctcatgttggaattgcttccagt
gaacccaaagttgcttcctacaaaaactttacagatacagttttaccaagaatcaaaaaa
cttggctataactgtgtccaactaatggctataatggagcacgcttattatgcgagcttt
gggtaccaggttaccaatttcttcgctgcatcaagtcgctatggtacacctacagaactg
caagagctgatcgatacagctcatggcatgggcctctatgtattgttggatgttgtacat
agccatgcctgcaagaatgttctggatggactgaatatgtttaatggaacggactcgtgt
tttttccattctggttccaggggagtccacagtcagtgggacagccggctcttcaactac
tcagagtgggaagtgctgaggtttctcatttccaaccttcggtggtatatggaggaatat
aagtttgatggtttccggtttgacggagttacttctatgatctaccatgaccatgcaatc
tcaagggggttttcaggagattaccatgagtattttggccttcagatggacatggagtca
ttggtgtacctgattcttgccaatgatatgataaagaccttccttcccgatgcaatcaca
attgcagaagatgtttctgggatgccaggaatgtgtaggcctgtcagtgaaggagggatt
gggttcgattaccgacttgcgatggcaatcccagaccagtggattaagatccttaaagag
gcgcgggatgaggattgggacatggatcatatcttccatacactcactaaccgaaggcat
ggggaactttgcattgcatacgctgagagtcatgaccaagcgcttgttggagataaaagc
cttgctttctggttgatggataaagagatgtacacgcacatgtcagagtgcacccacctt
actcctatcattgatcgtggcatctcacttcataagatgatccgtctcattacacatggt
cttggaggagagggatatctcaatttcatcgggaatgagtttggtcatccagagtggctg
gacttcccaagagccggaaacagttcaagttaccattatgctcgccgtcagtttcacctt
gtggatgataacctgttgaggtataagttcctttacaagtttgactctgccatgcagaat
acagaggaaacatatggttggttagcagcaaaacaagcctatgttagtagaaagcacaac
ggtgacaaggttttcgtattcgagcgagccggggtcttgtttctattcaacttccatcat
tcacaaagtttcactggttatagggttggagtccaaaacccaggaaaatacaagattgtt
ttagattctgatgactcagagtatgggggacacaatagaaatgataagtctgtgaggttc
ttcacggaagagatggcttttgatggtagagagcattctatgctcgtatatctgccttgt
agatctgctatgataatggcaaaggatgacactgactaa

DBGET integrated database retrieval system