KEGG   Ciona intestinalis (sea squirt): 100184804Help
Entry
100184804         CDS       T01056                                 

Definition
rho GTPase-activating protein 5-like
Orthology
K13709  
Rho GTPase-activating protein 5
Organism
cin  Ciona intestinalis (sea squirt)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
Un
AA seq 1574 aa AA seqDB search
MSKEKRKSVFNIAVVGLSGTEQIKGESGVGKSCLCNRFVREEADNYYPDHTSVLSQSDFG
GRVVNNDHFLFWGDVTKKDDSGIDYKFNVIEQTEFIDDQSYQPHRSSSNQLYVKRCAQTK
ISSAEKMMYICTDQLAIESDFDVKLMPEGKVVIDGFILCFDVSFVKYRTIDDQVRFVQNV
YHYLAKTKKPILFALTKCDEALNPFVAEAMKFAASCGGKRSSGIPVVETSASENINVTQA
FLNLAQLIDKSRSKSKIASFEDAAQVRKELLKDAKKKLETLLAHTVVKYDESWTTARKTL
ENELDYQRFVDLEGKNAASKIFRKHVNRLRDEYRSELQSKYLHYLPRALKLILPNVVSLR
PTWNDTLLLMSKNPKFDSWIVSLDSINSDTGGRPVVPWYEHKHINSLEDRRIPYELLLTL
EAEQIFRFHRQELEVVQRRCEVKDKFREMLAHSPQVTPGREWDEVAKFFKQNNFFNEISE
NELSTIYEQFQTEITEKAKENFQELLWEKLDIFASNNNGTHMDIQGIASCHDALKEDPRY
IAMAKLPKQRDEILNRHISETLYPPVDTWGSECLGKVLQVKRDLKSGKHQNSFIPSPSLR
WQLKEGSDSLNVVLLGADGLSHELANEITVHSSDDEYTLDGCIHQLRLRSIDGNVRLLSN
SFKTSSFSPHGCIAVYSSMESLRYIEKSLENTVMSLPDQAEAPPFQGLPVSILLASYSNS
EKEVHKLRDAGERLASRIGCPFIDVLPPEYAYNRRFHESQIRLAMRSLIEGIKERAGSGR
NSTVDPDQSGGVGVDGTLSPDLRIIMCTRKGDLSAAEIALFPLLNHTSFRDCPPKDTEEE
DDDAELPDSVVIETYLGNRRRRIAVTLTSYQSARHLLSKGHPLHGFILVYDTMRKSSFSI
LKVFANNTASAYPLLLLCVSPNEERPPAAAFFQQNKIARQLVVDGNTLADKLQAKFVSAS
SKHRHQPQVYSTFFKDAWEHKEDTEAIHRISRVVVESNDDVKEDEREENGTGSSTPRSSA
SERKSFGGEYKTSYEVPYVDSDIAPPNSLHFNVSSQSTYTESPSTCDADRATPSSTWSSS
DDYRPETPRASPTAGLIDNEMNPAYDNCEPYTKKTSQPSHLYPNNSTNAPGKLNPDLLNR
VAAGIKKQPVRQALLLRQQSLSDTLAPEPSHEPPYMTVHDPTKVGFRVLPPGYEQGKQNE
SKADESSEKSNHLPRSSAITSSISHKWQPKSMKRSLKTSDIESPTATTPPTIRSSRHSTA
DVLSQSYNAPKNDDTVSLGRGFTSSQEDLLHPSPSVLSSSSVVKGLLERSSHTPKDEKLW
RKEEKRRKEEEKKKEKEQRIRYKEKQKQNQSTRHPPNSVAIGNKHNVSDYFNKNLDEIIQ
GLNHMVPLFVEKCVQFLETYGLSTEGLYRIPANAKERENLIRRFDEDNTIEFNATEVSVS
TITGSLTWFFSQRNLPDPLIPYHLHDELEEAVGMPDASLKVCSVRGVIRKLPYANYATFK
YLCTHLRTVSDNEAENKMSSENLAICWWPTLFRPEVDLSLNSAAVAGMTKICFRDVLLAC
INQYAFIFYGKQEV
NT seq 4725 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaagaaaagagaaagagtgtattcaacattgctgttgttggattatctggaaca
gaacagataaaaggtgaaagtggggttggcaaatcatgcctgtgtaaccggtttgttcgt
gaggaagccgacaactattaccctgatcatacctctgtcctcagtcagtcggattttggt
ggcagggttgtcaacaacgatcacttcttattctggggtgacgttacaaaaaaggatgac
agtggaattgattacaaatttaatgtaattgagcaaaccgaatttattgatgatcaatca
tatcaacctcaccgttcctcatcaaatcaactttatgttaaaagatgtgctcaaaccaag
atttcatcagcagaaaaaatgatgtacatttgtaccgaccaacttgccattgagtcagac
ttcgacgttaaattgatgccagaaggaaaagttgtcattgatggtttcatcctttgtttt
gacgtcagttttgtcaaatatcgaacaatagatgatcaggttcgttttgtgcaaaacgtg
taccactaccttgctaagacgaagaaaccaattttatttgcgctcacaaaatgtgacgaa
gccctcaacccatttgttgctgaagcgatgaagtttgctgcaagctgtggtggaaaacgt
agcagtgggatacctgttgtggagacttctgcttcagagaacattaatgttactcaagca
tttcttaacctcgctcaacttattgataagtctcgctcaaaatcgaagattgcttcgttt
gaagacgcagctcaagtgagaaaggaattgttaaaagatgcaaagaagaagttggagacg
ttacttgcacatactgtggtcaaatatgatgaatcgtggaccactgcaagaaaaacactt
gaaaatgagttggattatcaacgctttgtggatttagagggtaaaaatgctgcttccaag
atctttcgaaagcatgtgaatcggttaagagacgaatacaggagtgagctacaaagcaag
taccttcattaccttccacgtgcgttgaaacttattctacctaatgttgtttcattgaga
ccaacatggaatgacacactcctgctcatgtcaaagaacccgaaatttgacagttggatt
gtttctttggattcaataaactcagataccggaggtcgtcccgttgttccgtggtacgaa
cataagcacattaactccttggaggatcggaggattccatacgaactcctcctcactctg
gaggcagagcagatcttccggtttcatcgccaggagctggaagtcgttcaaagaagatgt
gaagtgaaagataagttccgggagatgttggctcactctccgcaggtaactcctggcagg
gaatgggacgaggtggcgaagtttttcaaacaaaacaatttctttaatgaaataagtgaa
aatgaattgtccaccatttatgagcaatttcagactgaaattactgaaaaagctaaagag
aacttccaggaactgctgtgggagaaattggatatttttgcttctaacaataacggaaca
cacatggatattcaaggcattgcatcttgtcatgatgcattaaaagaagatcctaggtac
attgcaatggcaaaacttcctaagcaacgagatgaaattttaaatcgtcacatctcggaa
acgttgtacccccctgtagacacatgggggtcagagtgcttgggtaaagtattgcaagta
aagcgtgatttaaaatcgggaaaacaccagaacagttttatcccatctccctcactgagg
tggcagctgaaggaaggttctgattcattgaatgttgtcctacttggtgctgatggtttg
tctcatgaactagcaaatgaaatcacggtacattcatctgatgacgaatacacattagat
ggttgcattcatcagttaagacttcgtagtattgatggtaatgtacgtttgctctcaaac
tcattcaagacttcatcgttttcaccccatggttgtattgctgtctactcatcaatggag
tctctacgttacattgagaaaagtttagaaaacacggtgatgtctcttcccgatcaagca
gaagctcctcccttccaaggattgcctgtctctatattgctcgctagttattccaactct
gaaaaagaggttcataaactccgggatgcgggagagagattggcatctcggatcggatgt
ccattcattgatgttcttcctccggagtacgcatacaatcgccgcttccatgaatctcag
atccgactcgcgatgcggtcgcttatcgagggaatcaaggagcgagctggaagcgggagg
aacagcactgttgatccggatcagagtggaggagtgggagtggatggaacactctccccg
gacctcaggatcattatgtgcaccaggaaaggagatttatctgctgccgagatcgctctt
ttccctcttcttaaccacacctcctttcgtgactgcccgcctaaggacacagaggaggaa
gatgatgatgctgaactccctgactccgtcgtcatcgaaacttatcttggtaatcgccgg
cgacggatcgccgtcacactcacttcgtaccaaagtgcgcgacacttactcagcaaaggc
caccccttgcatggatttattcttgtttatgatacgatgaggaaaagctcattctcaatt
cttaaggtgtttgcgaacaacacagcgagtgcgtacccccttttactgctgtgcgtttcc
cctaacgaagagcgacctccagcggctgcgttttttcagcaaaacaaaatcgctcgacag
ctggtagtcgacggcaacacacttgccgacaaactgcaagcgaagttcgtgagtgcttcg
tccaagcatcgacaccagcctcaagtttacagcactttcttcaaagatgcgtgggagcat
aaggaagacactgaagctatccacagaatcagtcgggttgttgtcgaaagcaacgatgat
gtcaaagaagacgaacgagaggaaaacggaacgggaagttcaactccaagatcatctgca
tcggagaggaagagttttggtggcgaatacaaaacaagttatgaagttccgtacgtggac
agtgacatcgcacctccaaattcccttcatttcaatgtttcaagtcaaagcacttatact
gaaagtccaagtacctgtgatgcggatcgtgcaactcctagttcaacttggtcaagcagt
gatgattacagaccagaaacaccacgtgcaagtccaactgctggattaatagataatgag
atgaacccagcctatgataattgtgaaccttacactaagaagacgtcgcaaccaagtcac
ctttacccgaataactcaacaaatgctccgggaaaactcaaccctgatctcttaaacagg
gttgctgctggaatcaaaaaacaaccggtcagacaagcgttgcttctccgccaacagagt
ctatcggacacgcttgccccggaaccatcacacgaacccccatatatgacggtacatgac
ccaaccaaagttggattccgtgttttacctccgggatatgaacaagggaagcaaaatgaa
agcaaagctgatgaatcaagtgagaaaagcaaccacctgccccgtagttctgccatcacc
agcagtatttcccacaaatggcaacctaagagcatgaaacgttcgttaaagacgtcagac
attgaatcacccactgctacaaccccccctactattcgatcatcacgacactcaactgcc
gatgttttatcacagtcgtacaatgctcctaagaatgacgatactgtaagtttagggcga
gggtttacctccagtcaggaagatcttcttcatcctagtccctctgttctctcatcctct
tccgtggtaaaaggactcttagagaggtcctcccatactcccaaggatgagaaattatgg
aggaaagaagaaaaaagaaggaaagaagaggaaaagaaaaaggaaaaagaacaacgtatt
cgatataaagaaaaacagaaacaaaaccaatcaaccagacatcccccaaactcagtagca
atcggaaacaaacataatgtttcagattatttcaataaaaacttggatgagataattcaa
gggttgaatcatatggttccactctttgtggagaagtgtgtgcagtttcttgaaacttat
ggtttatcaactgaaggattatacagaatacctgccaacgcaaaagaaagagaaaattta
attcgaagatttgatgaagacaatacgattgagttcaacgcaacagaagtttctgtatct
acgataacaggtagtttaacctggttcttcagtcaacggaatttacctgatcctctaatt
ccttatcacctgcatgatgaacttgaagaagcagttggtatgccagatgcttcactgaag
gtgtgttcagtacgtggcgtcataaggaaactaccgtatgccaactacgctacgtttaaa
tacctgtgcacacatttaagaaccgtcagcgacaacgaggcagaaaacaaaatgtcaagc
gagaatttagcgatttgttggtggccgactctcttccgccccgaagtggatttgtcatta
aattccgcggctgtggcgggcatgaccaaaatatgtttccgcgatgttctattagcttgc
ataaatcagtacgcattcatattctacggcaagcaagaggtgtga

DBGET integrated database retrieval system