KEGG   Ciona intestinalis (sea squirt): 100184837Help
Entry
100184837         CDS       T01056                                 

Definition
(RefSeq) malonyl-CoA decarboxylase, mitochondrial-like
  KO
K01578  malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
cin00410  beta-Alanine metabolism
cin00640  Propanoate metabolism
cin01100  Metabolic pathways
cin04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:cin00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    100184837
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    100184837
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    100184837
Enzymes [BR:cin01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     100184837
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MCD MCD_N
Motif
Other DBs
NCBI-GeneID: 100184837
NCBI-ProteinID: XP_002128636
Ensembl: ENSCING00000021867
UniProt: A0A1W2WGD0
Position
5
AA seq 493 aa AA seqDB search
MCSRLLQAFPSVVHGVSTRFTRTLTGFTVKFVYETDNCVNGRAGRNPMVGRYRYSSIVNQ
SRALSTPAKQYEVLSHIEQVMTTFEDHKIHKFQSFLVSDDALVQICDAYFQLELNERAAV
LSWLCAKYGVQHNELLETCEILQKCINKRKDATLLLAESRMRLQLEPLYNQIFKLIGRLD
NGVKHLVDIRHDVETIAKSKAANIDVEQFQNLSNHLKVILSLWFSVGLLQLKRITWETPA
DILEKVGRNELVHQIRSWLDLKHRLGPDRRCYAFFHSSMQREPLVMLHVALTDTISSDIT
SIVDYSNKQVKSNEQPTTAIFYSISSTQNGLQGIDFGIHLIRKVVEEISKEFSTVNQFSS
LSPIPQFRSWFMTQLKLTAKSKSEHELLLPSEVKELSAILNVSNDSVYNSVWTILQDKAW
KIDDNLHKLLKVILVRACAHYLHNVKHRGFAFDPVANFHFRNGAMLWRINYNADPSIKGY
EASFGLMVNYRYF
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgtgttcaagattacttcaagcttttccctcagtggttcatggcgtgtcgacaagattt
acacgtacgctgacaggttttacggtaaagttcgtgtatgaaacagacaattgtgtcaac
ggtcgtgctgggagaaaccctatggttggcaggtaccggtactcgagtattgtgaatcaa
tcccgtgcattgtcaacgccggcaaagcagtatgaggtattgtcgcatattgaacaggtt
atgacaacttttgaagaccataaaatacataaatttcaaagttttcttgtttctgatgat
gcattggttcaaatttgtgatgcttattttcaattagaactgaatgaaagagctgctgtt
ttgtcttggttgtgtgctaagtatggtgtgcagcataatgaactactggaaacatgtgag
atattacagaagtgcattaataagagaaaagatgcaaccctcttgcttgctgagagccga
atgagacttcagttagaacctctctataaccaaatatttaaactaattggaaggttggat
aatggtgttaaacatcttgtggacattagacacgatgtagagacaattgcaaagtctaaa
gctgcaaatattgatgttgagcagtttcaaaatttgtcgaaccatttaaaagtaattcta
tctctatggttttcagttggacttttacaacttaaacgtattacttgggagacaccagca
gatattcttgaaaaagttgggaggaatgaattagtccatcaaattcgtagctggctggat
ttaaaacacagacttgggccagatcgtagatgttatgcctttttccattcaagtatgcaa
agggagccgctggtcatgctgcatgttgcattgactgatacaatttccagtgatatcaca
tcaatagttgattattctaataagcaagtaaaaagtaatgaacaaccaacaactgcaata
ttttattcaatttcttcaacccaaaatggtttacaagggattgacttcggcatccatttg
ataagaaaagtggttgaagaaataagcaaagagttttcgactgtcaatcagttctccagc
ttgtctccaataccccagtttcgaagttggtttatgacgcaactgaaactcacagccaag
tcaaagtctgagcatgaattgttacttcctagtgaagtaaaagaattatcagcaatttta
aatgtttccaatgattctgtgtataatagtgtatggaccattctacaggacaaagcatgg
aagatcgatgataacctacacaagctcttaaaagtgattttagttcgagcttgtgcacat
tatttacataatgtaaaacacagggggtttgcatttgaccctgttgcaaactttcacttc
agaaatggtgctatgttatggagaatcaattataatgcagatccaagtataaaaggatat
gaagcatcatttggtttaatggtaaattacagatacttttaa

DBGET integrated database retrieval system