KEGG   Ciona intestinalis (sea squirt): 100184966Help
Entry
100184966         CDS       T01056                                 

Definition
histone H2B-like
Orthology
K11252  
histone H2B
Organism
cin  Ciona intestinalis (sea squirt)
Brite
Exosome [BR:cin04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   100184966
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 121 aa AA seqDB search
MAPTKASSNSKRSTSSGSSGSGGKVKKGHEDFRNYLYKILKEIYHDTGITRQAMDSMNTL
MNYLFHIIAEEASSIMKAANRTTMAANDIQSAVRKVLPGELQKHAVSEGTKAVAKFKSFY
V
NT seq 366 nt NT seq  +upstreamnt  +downstreamnt
atggctcccaccaaagcttcaagtaattctaaacgttcaacgtcgtctggttcgtctggc
agcggcggaaaagtaaaaaaggggcatgaagattttcgcaactatctgtacaagatattg
aaagaaatttaccatgacactggcatcacaaggcaggctatggactccatgaacacacta
atgaactatctgttccatatcatcgctgaagaagcctctagtattatgaaagcagcaaac
agaacaacaatggcggcaaacgacatacaaagcgctgtgagaaaggttttaccgggtgag
ctacaaaaacacgcagtttcagaaggcacaaaagcggttgcaaaatttaaaagtttttat
gtatag

DBGET integrated database retrieval system