KEGG   Ciona intestinalis (sea squirt): 100184994Help
Entry
100184994         CDS       T01056                                 

Definition
replication protein A 32 kDa subunit-A-like
Orthology
K10739  
replication factor A2
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Fanconi anemia pathway
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:cin00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    100184994
   03420 Nucleotide excision repair
    100184994
   03430 Mismatch repair
    100184994
   03440 Homologous recombination
    100184994
   03460 Fanconi anemia pathway
    100184994
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
1
AA seq 262 aa AA seqDB search
MFQNAGGNDFGGGFGGGFGGGGGFSSPAAGGDKQKKFRFHNIVPIFASHLKEIVSDDSGF
KLGNTEVSQVTLVGTVIQVEHSQTCNTYKVDDTTGFVTVKHWNSFTEDEDAPVNEDVFEE
GTPVRVFGQMRVFQKNITLNGLHVRKVEDLNEITVHMLEVMHFKLATDAKKKGFDMGPTS
SGFQGNVSNNDQSMDLGMDSVQTQVWKLIQSATDDDGISITNIRSSLKGLNINQIKKAVD
FLCNEGHIYSTIDDDHFKTTSF
NT seq 789 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaaaacgctggaggaaatgattttggtggaggatttggaggtggctttggtggg
ggtggaggattctcatctcctgctgccggtggtgataaacaaaaaaaatttcgattccac
aacattgtccccatatttgcttctcacttgaaagaaatcgtgtccgacgactctggattc
aaactgggcaacactgaagtaagccaggtcacattggtgggaactgtaattcaagttgag
cacagccagacatgcaacacttacaaagtggacgatacaactgggtttgtcacagttaag
cactggaattctttcactgaggatgaagatgcgccagttaatgaagatgtttttgaagag
ggcacgccagtgagggtctttggtcaaatgagagtttttcagaaaaacatcactctgaat
ggtttgcatgtcagaaaagttgaagatttaaatgaaattacagttcatatgttggaggtt
atgcacttcaaactcgctacagatgctaagaaaaagggctttgacatgggacctacgtca
agtggatttcagggcaatgtttcaaataatgatcagtcaatggacctgggaatggattct
gtgcaaactcaggtttggaagcttattcaatcagctacagatgacgatggcataagtatc
actaatattcggtctagtttgaaaggtttaaatatcaaccaaatcaaaaaagctgtggat
ttcctgtgcaatgaaggccatatttactcaacgattgatgacgaccatttcaaaactaca
agcttctga

DBGET integrated database retrieval system