KEGG   Ciona intestinalis (sea squirt): 100185085Help
Entry
100185085         CDS       T01056                                 

Definition
[Pyruvate dehydrogenase [lipoamide]] kinase isozyme 2, mitochondrial-like
Orthology
K00898  
pyruvate dehydrogenase kinase 2/3/4 [EC:2.7.11.2]
Organism
cin  Ciona intestinalis (sea squirt)
Brite
Enzymes [BR:cin01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.2  [pyruvate dehydrogenase (acetyl-transferring)] kinase
     100185085
Protein kinases [BR:cin01001]
 Serine/threonine protein kinases: Atypical group
  PDHK family [OT]
   100185085
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
1
AA seq 428 aa AA seqDB search
MRLINRTLASHLRKSSQHRPKKNDSLRQMIEYYSRFSPSPLSLRQFLDFAQKTGDEKTSF
SWLRQELPTRLANMVKEMNRLPDELLVMPSTKLVTSWYNTSFEEVIDFDKNKTDAKNIER
FHKVLQGIIQRHRNVVETMAHGIMEWKEKCGNDQSFHQTYQDKIQYFLDRFYTSRIGIRI
LINQHILLFGDSAVRHPNLYGTIDPNCDVPLVVEDAFTTAKFLCEQYYMGSPEVNVHVHN
VSDKEKDSVTIIYAPSHLHHICFELFKNAMRATMERHPDVVDVPPINVWITKGGSDCSIK
ISDAGGGAARQMTTRWFEYLYSTAPRPPRSEDARVTPLAGYGYGLPISRLYARYLGGDLQ
VQSMEGYGTDAYIYLKSLSTAAVETVPVFNATTTEQYRRPMLTGDWVVPANQKHKQFMNP
FNGKTCKH
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaggttgatcaatcgtacacttgcctcccatctccgcaaatcaagtcaacatcgaccc
aagaagaatgactccctgcgtcaaatgattgaatattacagcaggttttccccaagccct
ttatctttacggcaatttcttgattttgcccagaagacaggagatgaaaaaacttcattt
tcctggctgcgacaggagttaccaacaagactggccaacatggtgaaggaaatgaacaga
ctacctgatgagttgttggtaatgccttcaactaaacttgtaacttcatggtacaacact
tcatttgaggaagttatagactttgataaaaacaaaactgatgcaaagaatattgaaagg
ttccataaagtgttgcaaggtattattcaaaggcatcgaaacgtggttgaaacgatggcc
cacgggataatggagtggaaggagaagtgtgggaatgaccaatccttccatcaaacatac
caggataaaatccaatatttccttgatagattctacacgagtagaatcggtattcgaatc
ctgatcaaccaacacattcttttgtttggtgattctgctgtgagacaccctaacctatat
gggacaattgacccaaattgtgacgtaccattggtggtagaagatgcttttaccacggct
aagtttctatgtgagcagtattacatggggtcacctgaggtgaacgttcatgtgcataat
gtttctgacaaggaaaaggacagtgtgacaatcatatacgcaccttcacatttgcatcat
atttgttttgaactatttaagaatgcaatgcgtgctaccatggaaagacaccctgatgtt
gtggatgttcctccaatcaatgtgtggatcactaagggaggatctgattgctccattaag
atctcggatgcgggaggtggtgctgctcgccagatgaccactagatggtttgagtatttg
tacagcactgcaccgagaccccctcgtagcgaggatgcacgagttactccattggctggg
tacgggtacggcctcccaatatccaggttatatgcacgatacttgggcggtgacttacaa
gttcaatccatggaaggttatggcacagatgcttatatttacttgaagtccttatcaacc
gccgctgttgaaactgttcccgtgttcaacgcaacaactacagagcaatacaggcgacca
atgcttactggtgattgggttgtaccggccaatcagaaacacaaacaattcatgaatccg
ttcaatggcaagacatgtaagcattaa

DBGET integrated database retrieval system