KEGG   Ciona intestinalis (sea squirt): 100185121Help
Entry
100185121         CDS       T01056                                 

Definition
cytochrome P450 1A1-like
Orthology
K07410  
cytochrome P450, family 1, subfamily B, polypeptide 1 [EC:1.14.14.1]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Tryptophan metabolism
Metabolism of xenobiotics by cytochrome P450
Brite
KEGG Orthology (KO) [BR:cin00001]
 Metabolism
  Amino acid metabolism
   00380 Tryptophan metabolism
    100185121
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    100185121
Enzymes [BR:cin01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     100185121
Cytochrome P450 [BR:cin00199]
 Cytochrome P450, animal type
  CYP1 family
   100185121
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
5
AA seq 578 aa AA seqDB search
MDSLVFVLVDTVLVMKYQILLFLVIVYAIKLLATSQSRRLNIPGPYPWPVIGNVIEMGGQ
PQFSLTNMAKKYGPVYLMKLGTADVLVLNNYEVIKEALLRQRRIFGGRPIFDSFKKISQG
RGVVFNSTMTQGDEWMKLKMTIVKHVHRFVSSEETKGYVAHHVQMEAVELVRILTEKCRS
SPNKVIFPIEQINLAIANVVCAIMFGHRYQHGNKIFPKFRNALKVFDFLTNRLNDWMRLR
TKEHRLTYKHGVIRDIVDSFIAESIDHPEQSALNDDVIMALTTDVFGAGQDTMSTTMQWV
FVYMMHFKECQRKIHAELDSVIGPGELPHISDRRRLPYLEAVMHEIFRHSTFTSTTIPHV
TTQDTVLDGHFIPKGILVFINQFGANHDPNHWVDPDKFIPERFLDGKGNLISRPHDRYLL
FSTGARKCPGDELSRMLILHFMATMFALCEVSSDPKKPATLDAVYNLSMRPKELRTIVRS
RNLPFLKNSVAQMSEADSHVLTVPGETTSFLTSRVESTVPDNQESQFSDNDFEKVDTKIP
KRKVFSRPTLTHDDINGNNVRKRGNLHQSAMYRIQLAT
NT seq 1737 nt NT seq  +upstreamnt  +downstreamnt
atggattcgttggtgttcgtgctggtggacacagtgctggtgatgaaataccaaatcctt
ttatttttagtaattgtctacgccataaaactattagcaacgtcacagtcaaggcgcttg
aacattcctggtccttacccgtggccagtgatcggaaatgtgatagaaatgggaggccaa
cctcagttttcactgacaaacatggcgaaaaagtacggacctgtgtatttgatgaaactc
ggaactgctgacgttctggtgctcaacaattatgaagtcatcaaagaagcattgttacgt
caaagacgcatctttggtggccgaccgatattcgattcatttaagaaaatttctcaaggt
cgaggggttgtctttaacagcacaatgacacagggagacgaatggatgaaactaaaaatg
acaattgtaaagcatgttcaccgttttgtatcctctgaagaaacgaaaggatatgttgca
caccatgtacaaatggaagccgtggaactcgttcggatccttaccgaaaagtgccgaagt
tctccgaacaaagtgatttttccaatcgagcagatcaacttggccattgcgaacgtcgtg
tgtgcaatcatgtttgggcatcgataccaacacggaaacaagatttttccgaagtttcga
aacgctctaaaagttttcgattttctcacaaatcgattgaacgattggatgcgactcaga
acaaaggaacacagactcacatacaaacatggtgtgattcgcgacatcgtcgatagcttt
atcgcagagtcaatcgaccacccggaacaatcagcacttaatgatgacgtaataatggca
ctgaccacggacgtgttcggggctggacaagacacgatgtcaactactatgcaatgggtc
tttgtatatatgatgcattttaaagaatgccagcgaaagatccatgccgaacttgactca
gttatcggccccggagaactcccgcatatctctgaccgacggcgtcttccatacttggaa
gcagtaatgcacgaaatatttcgtcattcgacatttacgtccaccacaatacctcatgtt
accacacaagatacggttttggatggacactttatccccaaaggtatccttgtgttcatc
aatcagtttggcgcaaaccacgacccaaaccattgggtagaccccgataagtttattcct
gaaaggttcctagatgggaaaggaaatcttatttctcgtcctcacgatcgctaccttcta
ttttccactggagcaaggaagtgccctggagacgaactttcccgaatgctgatcctgcat
ttcatggcaacaatgtttgcattgtgtgaagtttcatctgatcccaagaagcctgctaca
ctggatgcggtttataatctctcaatgcggccaaaagaactgcggacaatcgtacgcagt
agaaacttgccgttcctgaagaattcagtcgctcagatgtccgaagccgattcgcacgtt
ctcacagttcctggcgaaaccacctcatttttaacttcgcgtgtcgaaagcactgttcca
gataatcaggaaagtcaattttcagataacgatttcgaaaaagtggataccaaaataccg
aaacgtaaagtgttttcgaggccgacactgacgcatgacgacattaacgggaataacgtt
agaaaacgtgggaatctccaccaaagcgcaatgtatagaattcagcttgccacataa

DBGET integrated database retrieval system