KEGG   Ciona intestinalis (sea squirt): 100185149Help
Entry
100185149         CDS       T01056                                 

Definition
putative glucose-6-phosphate 1-epimerase-like
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:cin00010]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
Un
AA seq 271 aa AA seqDB search
MSKETITLNSGTSSCKIHLFGATVISWLCKGKERLFLSTDAIMDGSKAIRGGIPIVFPNF
GPWKCGPQHGIARISWWKVVVQPVQLDNGDTQVVLELTDDEKSRKTWSYSFKLQYTVTLS
SSTLTSSLQITNTSTTSFDFTTLLHTYIRVDDIKDTTVSGLEGCAYKDKVTSSDGIEQDT
EVKISINVDRVYTDTKHHVVTHAGGRIQVEKEGLPDTVLWNPWIEKSQAMSDFNNDGWMN
MVCVEPGFVGKRKVLGAGEEFGCKQTLTVLD
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaggagacaataacccttaatagcggaacttccagctgcaaaatccatttattt
ggtgcaacagttatatcatggttgtgtaagggtaaagagagattgtttctcagcactgat
gctataatggatgggagcaaggccattaggggtggaatacctatcgtgtttccgaacttc
ggaccatggaaatgcgggccccaacatggtattgcaagaatttcctggtggaaggtggtg
gtgcaacctgtgcagttggataacggcgacactcaagttgttttagaactaactgatgat
gaaaagtcaaggaaaacatggagttacagtttcaaactccaatacactgtgaccttgagt
tcatctactttaacaagctccctgcaaataactaacacatcaaccactagctttgacttc
actacattgctacacacttatattagagtggatgacatcaaggacaccactgtgtctggg
ttggaaggatgcgcttacaaggataaggtcacctctagtgacggcatagagcaagatact
gaagtaaagatatcaataaacgtagatcgcgtatatacggataccaagcaccatgtagta
actcatgctgggggaaggatacaagtggagaaggagggactccctgatacagttctatgg
aatccatggattgagaaatcgcaagcgatgtccgatttcaacaacgatggttggatgaac
atggtttgtgtagaaccagggtttgtggggaaacgtaaggtgttgggggcgggggaggag
tttggatgcaagcaaacattgactgttcttgattga

DBGET integrated database retrieval system