KEGG   Ciona intestinalis (sea squirt): 100185182Help
Entry
100185182         CDS       T01056                                 

Definition
glucosylceramidase-like
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Lysosome
Brite
KEGG Orthology (KO) [BR:cin00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    100185182
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    100185182
 Cellular Processes
  Transport and catabolism
   04142 Lysosome
    100185182
Enzymes [BR:cin01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     100185182
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
4
AA seq 549 aa AA seqDB search
MTITSQKGFPIIILICGVAGTTLLCSLLVVFLPKDALPESHIDQEQEKAGDLPCASRMYN
SDSVVCVCNSTYCDTISEVPVIPSGQAITYTSSKSGLRFAKQTLNFQSGTPSSGRNLIVN
TTDRFQKLIGFGGAFTDAAGINIASLSSEAQNYFLRSYFSDQGIGFNMGRIPMASVDFST
HLYTYADQPNDFEMKNFSLASEDFQYKIPYIKKAVEMSNRTSFRLFGSPWSAPAWMKTNK
ALIGKGSLIGRAGNKYHKAWALYFARFLEEYKANGVDIWAVTAQNEPIDGLARNFSFQCM
GWTAEHQRDFIKTDLGPTLHSRGHGDVKVIIGDDQRLVFPRWAEVVLNDTSASQYVSGIG
VHWYMDWILPISRISDTHKAFPDYFILGTEACSGAMPFQPDKVILGSWTRGQRYSMDIIQ
DLNHWVAGWVDWNLALDLEGGPNWVKNFVDAAIIVNAESDEFYKQPIFYHLGHFSKFLRE
DSVRISLHEENEESSLKHVAFIDDEKSIVTIVLLNTSQQNQTINVIYDKFYVRTELPADS
IQTVVFNSL
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgacaattactagccaaaaaggatttccaattataattttaatatgtggagtagcaggg
acaactttgttatgctcgttgcttgttgtgtttttaccaaaagatgctcttccggaatca
catattgaccaagaacaagaaaaagcgggcgacctgccatgcgcatctcgaatgtacaac
tcggattcggttgtgtgcgtgtgtaactctacttactgcgacacaatttctgaggttcct
gtaataccaagcggacaagccataacatatacgtcttctaaaagtggtctgagatttgca
aaacaaaccttgaactttcaaagcggaacaccgtcatccggcaggaacctcatagtcaac
accacagaccgatttcagaaactaattggttttggtggagcttttactgacgctgctgga
attaacatagccagtctatctagtgaagcacagaactattttctgcgttcgtacttttca
gatcaaggtataggctttaatatgggccgaataccaatggctagcgtcgacttttctaca
catttatatacttatgctgaccaaccaaacgacttcgaaatgaaaaactttagcttagca
agtgaagattttcaatacaagattccttacattaaaaaggctgtggaaatgagcaacaga
acaagttttcgtctattcggtagcccatggagcgcccctgcttggatgaagacaaataaa
gcgcttatcggaaaaggaagtcttattggaagagccgggaacaaatatcataaagcatgg
gctttgtattttgccagatttctcgaagaatacaaagcaaatggagtggatatttgggcg
gtcacagctcagaacgaaccgatagacggcctagcaagaaacttcagttttcaatgtatg
gggtggacagctgaacaccagagggactttattaaaactgatttgggtccaacccttcat
tctcgaggccacggcgacgtcaaagtaattattggggacgaccaacgcctggtatttcca
agatgggccgaagttgttttaaatgacacatcggcatcgcaatacgtatctggaataggc
gtacactggtacatggattggattctgccaatatcaagaataagcgatacacacaaagca
ttcccagattactttatcttaggcactgaagcttgttctggagcaatgccattccaaccc
gataaagttattttaggcagttggacaagaggacaacgctacagcatggatattatacag
gatttaaaccactgggttgccggatgggtcgattggaacttagcactagatttggaagga
ggaccgaactgggtcaaaaattttgttgacgctgctattatcgtgaacgctgaaagtgac
gagttttataaacagccgatattttatcacctcggccatttcagcaaattcttgcgtgaa
gattcggtccgaatatctcttcatgaggagaacgaagaaagcagtttgaaacacgttgcg
tttattgatgatgaaaaatcaatcgtaacgatcgttcttttaaacacctctcaacaaaac
cagacgatcaatgttatttatgacaagttttacgtgcgcacagaactaccagcagattcc
attcaaactgttgttttcaactctctgtaa

DBGET integrated database retrieval system