KEGG   Ciona intestinalis (sea squirt): 100185185Help
Entry
100185185         CDS       T01056                                 

Definition
asparagine synthetase [glutamine-hydrolyzing]-like
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
cin  Ciona intestinalis (sea squirt)
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cin00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    100185185
Enzymes [BR:cin01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     100185185
Peptidases [BR:cin01002]
 Cysteine Peptidases
  Family C44
   100185185
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
2
AA seq 564 aa AA seqDB search
MCGIWALFGYDANDVRQFTCAQTIAHRGPDNFRFENVSGLRSAKLAFHRLEVVGDVGGMQ
PMRLHQYPHLTLICNGEIYNCQKLKEEFGFNHETPSDCEVILHLYNKFGPEETSKYLDGV
FAYVIVNTRDNTLLLSRDTYGVRPMFYFMTNNGMMGVCSEAKGLYDLLKKKNGEDKTKLL
RVFPPAHSMVCDVIKNGKIAPATPKMFHSFPELPRHFMYQGVVLEKGESDDVIKKNIRTL
MINAVEKRLMSSRRVGSLLSGGLDSSLVAAITAKKLRENGSKQPIQTFSIGMETSPDIVA
ARKVAEQIESEHHEVIFSPEEGLDAIEETIYALESYDVTTVRASIPMYLLSKYISQNTDT
IVIMSGEGADELAQGYIYFYKQPTQEEGDVESRRLLSDLYLFDVLRTDRSTAAHGLEVRA
PFLDHALTSYYLSLPAEKRAPSEGNIEKFLLRSAFDESDLIPSEILWRRKEAFSDGVASK
RRSWFEILQEHIESRVNDDALAKAKETHPFHTPKTKEALYYRQIFESKFGPQLSKLIPYQ
WLPKWIEAVDPSARVLTHYQNDEA
NT seq 1695 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggaatctgggctctgttcggttatgacgcgaatgacgtcagacagttcacttgt
gcgcaaacaatcgcacatagaggtcccgataattttcggttcgagaacgtgagtggactt
cgaagcgctaaacttgcttttcaccgattggaagtagttggtgacgtaggcggaatgcag
ccaatgagattacaccagtaccctcacttaactttgatatgcaacggagagatttacaat
tgtcagaagttaaaggaagaatttgggtttaaccacgagacaccctctgactgtgaggtc
atattacatctgtacaataagttcggcccagaggagacgagcaaatacctggatggcgtg
ttcgcttacgtcatcgtaaacacgcgcgacaacaccttattactgtcacgtgatacatat
ggagttcggccgatgttttatttcatgacaaacaatggaatgatgggagtctgctcggag
gctaaaggtctttatgacttactcaagaagaaaaacggcgaggataaaacaaagctgctt
cgcgtgtttcccccggcccattctatggtttgtgacgtaataaagaacgggaagatcgct
ccagcgacgccgaagatgtttcattcattccccgagctgccacgccacttcatgtaccaa
ggggtcgttttagagaaaggcgaaagtgatgacgtcataaagaagaacattcgaacgttg
atgataaatgctgtggaaaaaaggttgatgtccagcagaagggtcggaagcttattatca
ggaggattagattcttcattggttgccgccattactgcgaagaaacttcgagaaaatgga
tcaaaacaaccgatacaaacattttcaattggaatggaaactagccctgacatcgtggca
gctagaaaggttgcagagcaaattgagagcgagcaccatgaagtgatattctcgccagaa
gaaggattagatgcgatagaagaaaccatatacgcattggagagttatgatgtcacgacc
gtgagagcttcaatcccaatgtacttgttatcaaagtacatcagtcagaacacggacaca
atcgtaatcatgtcgggagagggcgctgacgagctcgctcaaggttacatctacttttat
aaacaaccaacccaagaagaaggggacgtcgaaagcagacggctattatctgatctctat
cttttcgatgtgttacgtaccgatcgctcgacagccgcgcatgggctggaagttcgagca
ccattcttggaccacgccctaacgtcttactatctatcgttgccggcagaaaaacgggcc
ccgagtgagggaaacattgagaaattccttcttcgttccgcgttcgatgaatcggatctc
ataccatctgaaatattatggagacgcaaggaagcattcagcgatggagttgcctcgaag
cgaagatcttggtttgagattctacaagaacatatcgagagcagggtaaatgacgatgct
ctcgcaaaagcaaaagaaacacacccattccacacccctaaaacaaaagaggcgctctac
tatagacaaatctttgaatcaaagttcggcccacaactgtcgaagctgatcccataccaa
tggttgcctaaatggatcgaagcggtagatccaagcgctagagttcttacgcattatcaa
aatgatgaggcgtaa

DBGET integrated database retrieval system