KEGG   Ciona intestinalis (sea squirt): 100185456Help
Entry
100185456         CDS       T01056                                 

Gene name
usp15
Definition
ubiquitin carboxyl-terminal hydrolase 15-like
Orthology
K11835  
ubiquitin carboxyl-terminal hydrolase 4/11/15 [EC:3.1.2.15]
Organism
cin  Ciona intestinalis (sea squirt)
Brite
Enzymes [BR:cin01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     100185456 (usp15)
Peptidases [BR:cin01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   100185456 (usp15)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
1
AA seq 923 aa AA seqDB search
MGQLPENKGGGGAPQNLEAEKKKIQSLANQELKKNELWYLIDKRWYDQWKKYVENDGYGW
ESKNNSNLNPGPIDNTDIFTDETYEQMKDNLSEDVEFVMLPKTGWEYLVNTYGLVADGMA
IERKVIEQGSFFKKCVVEIYPMQLRLSPYDNRKEVVKRNFSKRNTVGEIEEEVRKTFQIP
EETPVKLWSAYLPSSLESLEKHKSVEDSALQPGQVVVFETKKDGKWMHTPTPTTSYVSSN
SQNGAHKSVNTYGLRNTSPTRGRVSTAGLCGLNNLGNTCFMNSALQCLSNVPALCNYFLN
ETYKKELNKTNPLGMGGKLAKAYARLVQSIWSGEQSSFAPREFKMEVGRFAPRFSGYQQH
DSQELLSFLVDGLHEDLNRISKKPYVEMKEADGRDDQLVAEESWSNHHLRNDSIIVDTLH
GLFRSKVDCPECPRISVTFDPFCFISLPLPLKRQRTLECSFVPLKYDGKIYKYQVTVNKT
GCIXDLCKAVSELNNIPSTEMTATDVYNSRFHKVFKPNEGINGIYEKDYIHVFQKPPNMT
MVPVYMRHLSSSGPNSSAHLFGQPFLVPVDIRNTTYRQLYKTVLKATWRYIKDDELKSDV
ARLICDEEYMDDKAEEDDEDCVQPSVHRLFSLKVVNSFGTQLLRVLHETDSPLDLSENTY
ITADWSYYVYEHQLMQHHWSDVSESHESMAACNIRKANSGVQLHDCMRLFTTEEQLDKDD
AWYCSDCKKHQQATKKFDLWMLPPVLIIHLKRFSYTRYSRDKLDTLVNFPTRDLDLSDFI
VNPNKGSLPKPKRCYNLIAVSNHYGGLGGGHYTAYAKNHIDKQWHYFDDSSVSLSSEDRV
VTKAAYMLVYQRQDMEAWLDDNPDKTFPYLEPIFSPRAMGLGGPACSAVGTSFKYDGVNA
SNGHQLDEDTLNNNNADDDMDTS
NT seq 2772 nt NT seq  +upstreamnt  +downstreamnt
atgggtcaactgcctgaaaacaaggggggtggaggggcccctcaaaatttggaagcagaa
aaaaagaaaatacagagtttagcaaatcaagaattaaaaaagaatgagctttggtacctc
attgacaaacgttggtatgatcagtggaaaaaatatgtggaaaatgatggatatggctgg
gaatcgaaaaacaactcaaacctaaaccctggcccaatagacaacacagacatatttact
gatgagacatatgagcaaatgaaggacaatctatccgaagatgtcgaatttgtgatgctc
ccaaaaactggttgggagtatttagttaacacatatggattggttgctgatggaatggca
attgaaaggaaggtgatagagcagggatcattttttaagaaatgcgtcgttgaaatttat
ccaatgcagttgagattatcaccatacgacaacaggaaagaagttgtgaaacgaaacttc
agcaaaagaaacacagttggtgaaattgaagaagaggttcgtaaaacctttcaaatccca
gaagaaacacccgtaaaactatggagtgcatatcttccttctagtttggaatccctagaa
aaacataaatctgttgaagacagtgcactgcaacctggtcaggtggtggtgtttgaaaca
aagaaagatggaaaatggatgcatacaccaacaccaacaacaagctatgtaagttccaac
tcacagaacggagctcacaaatctgtaaatacatacggtttacgcaacacatcacccact
cgtggcagggtttcaacagcaggtctatgcggtttaaacaaccttggcaacacttgcttt
atgaacagtgcactgcagtgccttagtaatgttccagcactctgcaactactttctcaat
gaaacatacaagaaagaactaaacaaaacaaatcctttgggcatggggggcaagttggcc
aaggcatatgcaagacttgttcagtcaatatggtctggtgagcaatcctcatttgctcca
cgagaatttaagatggaggttggtcggtttgccccaagattttcaggatatcaacaacat
gatagtcaggaacttctctctttccttgtagatgggctgcatgaagatttgaacaggatc
tccaaaaagccatacgtggaaatgaaagaagcagatggtcgtgatgaccaactagtggca
gaagaatcttggagcaaccatcatcttcgcaacgattcaatcattgttgacacattacat
ggtttgtttcggagcaaagttgattgtccagagtgtccaaggatctcagtgacatttgat
ccattctgcttcatctctcttcctcttcctttgaaaagacaacgaacacttgaatgttcg
tttgttccacttaagtatgatgggaaaatatacaagtaccaggtgacagtaaacaagact
ggttgtatangagatttgtgtaaagctgtatccgaacttaacaacataccaagcactgaa
atgacagccactgatgtctataactccaggtttcacaaggttttcaaacctaatgaaggc
atcaatggaatttatgagaaagattacatccacgtgttccagaaacctccgaatatgaca
atggtgcctgtgtatatgagacacctaagttcaagtggtccgaactcaagcgctcatctc
tttggtcaaccattccttgttccagtggatattcgaaacacaacataccgacaactttac
aagaccgttctcaaagccacatggagatatataaaagatgacgaactaaagtctgatgtt
gcaagattgatctgtgatgaggaatacatggatgataaagctgaagaagatgatgaggat
tgcgttcaaccttctgtgcaccgactattttcattgaaagtggtcaattcgttcggaact
caattgctaagggttttacacgaaaccgattcgccactggatttatctgagaacacctac
attactgccgactggtcatactatgtatatgaacatcaacttatgcaacaccactggtca
gatgtgtcagaaagtcatgaaagtatggcagcttgcaacatcaggaaagcaaatagtgga
gtccaattacatgactgcatgagactatttacaactgaagaacaacttgataaggacgat
gcatggtattgttctgattgtaagaaacaccagcaagccaccaagaaatttgatctatgg
atgcttccacctgttcttattattcacctcaagcgattctcttacaccagatactcaagg
gacaagcttgacacactggtgaacttccctaccagggatctagatctttctgacttcatt
gttaatcctaacaagggcagtttgcccaagccaaaacgatgttacaatctaattgctgtt
tccaatcattatggtgggcttggtggtggccactacaccgcctatgcaaagaatcatatt
gataagcagtggcattattttgatgacagtagtgtctccctatcctctgaagatagagtg
gtgacaaaagctgcatacatgcttgtctatcaacggcaagatatggaggcttggcttgat
gacaaccctgataaaaccttcccgtacttggagccaattttcagccctcgtgccatgggg
ttgggaggtcccgcgtgttcggctgtgggtacaagcttcaaatatgatggggtgaatgca
agcaatggccaccagctcgatgaagacacacttaacaataataatgctgatgatgacatg
gacactagttga

DBGET integrated database retrieval system